(data stored in ACNUC7421 zone)

EMBL: CP000769.PE263

CP000769.PE263       Location/Qualifiers
FT   CDS_pept        complement(309813..310169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0265"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ade:Adeh_2901 cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24483"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Y7"
FT                   /protein_id="ABS24483.1"
FT                   /translation="MARLVTTPFVVPAAGNPPKLIEELFGRVATGSAGVSVARMTSPPG
FT                   WAEPGQTPEFDEYTVVLEGALRVETREGVLEVGAGQAVHAPSGEWVRYSTPAGARYLAV
FT                   CVPAFSLDTVHRDG"
     atggcccggc tcgtcaccac ccccttcgtc gtccccgctg cggggaaccc gcccaagctc        60
     atcgaggagc tgttcggccg cgtcgccacc gggagcgcgg gggtgagcgt cgcccgcatg       120
     acgagcccgc cgggctgggc ggagccgggc cagacccccg agttcgacga gtacacggtc       180
     gtgctggagg gggcgctgcg cgtggagacg cgcgagggcg tgctggaggt gggcgcggga       240
     caggcggtgc acgcgcccag cggcgagtgg gtgcgctaca gcacgcccgc gggggcgagg       300
     tacctcgccg tgtgcgtccc ggcgttctcg ctcgacaccg tgcatcgcga cggctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page