(data stored in ACNUC7421 zone)

EMBL: CP000769.PE273

CP000769.PE273       Location/Qualifiers
FT   CDS_pept        321842..323203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24493"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6Z7"
FT                   /protein_id="ABS24493.1"
FT                   /translation="MRYARPARAMTSRSLEPKPLVVAVEMGYGHMRAAMPLADALGTEV
FT                   LQVDKAPLVAPGEERLWQRVRRTYEGVSRLSQVPWAGAPLRRALEAVTDIPRLYPYRDL
FT                   SAPTRGVHALDRLVRGRELGRGLVAELRRTGAPLLTTFYSPAIVADAAGVERVFCVATD
FT                   SDLNRIWAPVEPGRTHIRYLVPTRRAARRLRSYGVPEDRITFTGFPLPDALVGGTALGA
FT                   LKRNLAARIVRLDPSGEFRRSIPEELAHFLGALPAEEEGRPPLLAFAVGGAGAQAGMAA
FT                   ELLPGFRPALEGGALRICLVAGVRAEVAARFAEIVRRAGMEPLLGGPLEILLAPGFREY
FT                   YARFNALLARTDVLWTKPSELTFYGALGIPLVLAPPVGVHERYNLRWARESGAGLKQRD
FT                   ARFASEWLADGLADGVLAAAAWAGYMRLPKFGLQRILETVGAAPEARIAAPRGG"
     gtgaggtacg ctcggccggc acgcgccatg acctcacgct cgctcgaacc gaagccgctc        60
     gtcgtcgccg tggagatggg ctacgggcac atgcgcgccg cgatgccgct cgcggatgcg       120
     ctcggcacgg aggtgctgca ggtggacaag gcgccgctcg tggcgccggg cgaggagcgg       180
     ctgtggcagc gggtgcgccg gacctacgag ggggtctccc gcctgtcgca ggtgccgtgg       240
     gccggcgcgc cgctccggcg ggcgctggaa gcggtcaccg acatcccgcg cctctacccc       300
     taccgcgacc tctccgcgcc cacccgcggg gtccacgcgc tcgaccggct cgtgcggggg       360
     cgggagctgg gccgcgggct ggtcgccgag ctccgccgga cgggcgcgcc gctcctcacc       420
     accttctact cgccggcgat cgtcgccgac gcggccggcg tggagcgggt cttctgcgtc       480
     gcgaccgact cggacctgaa ccggatctgg gcgccggtgg agccggggcg cacgcacatc       540
     cgctacctgg tcccgacccg ccgcgccgcg cggcggctcc gatcgtacgg cgtgccggag       600
     gaccggatca ccttcaccgg cttcccgctg cccgacgcgc tcgtgggcgg gaccgcgctg       660
     ggtgcgctca agcggaacct ggcggcgcgg atcgtgcggc tcgatccctc gggcgagttc       720
     cgccgatcga tccccgagga gctcgcgcac ttcctcggcg ccctcccggc cgaggaggag       780
     ggccggccgc cgctcctcgc cttcgcggtc ggcggcgccg gggcgcaggc ggggatggcc       840
     gcggagctgc tgcccggctt ccgccccgcg ctggagggcg gagcgctgcg gatctgcctc       900
     gtggcggggg tgcgcgccga ggtggcggcc cgcttcgccg agatcgtccg gcgcgccggg       960
     atggagccgc tcctgggcgg gccgctggag atcctgctcg cccccgggtt ccgcgagtac      1020
     tacgcgcgct tcaacgcgct cctcgcgcgc accgacgtgc tgtggacgaa gccctcggag      1080
     ctcaccttct acggcgcgct ggggatcccg ctcgtgctgg cgccgcccgt gggggttcac      1140
     gaacggtata acctccgctg ggcgcgggag agcggcgccg ggctgaagca gcgggacgca      1200
     cggttcgcct cggagtggct cgccgacggg ctcgccgacg gcgtgctcgc cgccgccgcc      1260
     tgggccggct acatgcggct ccccaagttc ggcctgcagc gcatcctcga gacggtgggc      1320
     gccgcgcccg aggcgcgcat cgcggccccc cgcggcggct ga                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page