(data stored in ACNUC7421 zone)

EMBL: CP000769.PE280

CP000769.PE280       Location/Qualifiers
FT   CDS_pept        329846..331729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0282"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   ade:Adeh_0260 DnaJ like heat shock protein with
FT                   tetratricopeptide repeats"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24500"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A7H704"
FT                   /protein_id="ABS24500.1"
FT                   /translation="MSDGNGQGKAAGAQQPADEAPPRLDRVPPGYRPPPVRAATPPPRV
FT                   APEASARAAPPVPPRASYGLAEREVTAAAAIAAGLAREGSLRAEGALHLFLLAAANQAH
FT                   GRLALASGPVRYALTFRRGTVEHVASAAPEDGLGRFLVRRGALTPEQLVRADGACAPGG
FT                   DLVATLVAERLLAPSDVAALLGEHGASLVARALAVEDGSWSWEPGAAPPPSGFPLGNPY
FT                   GMAAAAVRAVDAAGAERRLGDRAGRAASRVVGRVRLEDLRLAPQEARLTGLFDGRSALE
FT                   LAAAHPADAATILRVALLLAEAELLAFGAARASPPRAVPGASASASSAAAAQPTSTPTA
FT                   PRNPEAGHPSAASGRDAQDRPRVASSAAARAPTSTPTAGARTAAHPERSAAAAAAERAR
FT                   GTPPVPVDPATLRALLQRLAAADHFEVLGVKRDAAPAQVKVAYFRLAKSYHPDAVPASV
FT                   SAEVRGLCADVFAKVSAAWAVLGDDAQRAKYLDELASGGAADVDVMRILQAENVFQAGT
FT                   VLVRARRYAEALEKFRDAAVLNEDEPEFAIWLAWCEFLVAKEPRAQHAASAAAIEDGLR
FT                   RNARCAPGYLFLAQMAKIVGDLSLAERHLRRGLAVAPEHVDLVRELRYLRK"
     gtgagcgacg ggaacgggca ggggaaggcg gccggggcgc agcagccggc ggacgaggcg        60
     ccgccgcggc tcgaccgcgt gccccccggc taccgcccgc cgcccgtccg cgccgcgacc       120
     ccgccgccgc gcgtggcgcc cgaggcttcg gctcgcgccg ctccgcccgt cccgccccgc       180
     gcgtcgtacg gtctcgccga gcgcgaggtg acggccgcgg ctgcgatcgc cgcgggcctc       240
     gcgcgcgagg gatccctccg cgcggagggg gcgctgcacc tgttcctgct cgccgccgcg       300
     aaccaggcgc acgggcggct cgcgctcgcc tccgggccgg tgcgctacgc gctcaccttc       360
     cgccgcggca ccgtggagca cgtcgcctcg gcggcgccgg aggacggcct cggccggttc       420
     ctcgtccggc gcggcgcgct gacgcccgag cagctcgtcc gggcggacgg ggcgtgcgcg       480
     cccggcggcg acctcgtcgc gacgctcgtg gccgagcggc tcctggcccc ctcggacgtc       540
     gcggccctcc tcggcgagca cggcgcgtcg ctcgtcgcgc gcgccctcgc cgtcgaggac       600
     gggagctgga gctgggagcc cggcgcggcg ccgccgccgt ccggcttccc gctcggcaac       660
     ccgtacggca tggccgccgc cgcggtgcgc gccgtcgacg ccgcaggcgc ggagcgccgc       720
     ctgggcgatc gcgccgggcg cgccgcctcg cgcgtggtcg gacgcgtgcg cctggaggac       780
     ctgcggctcg ccccccagga ggcgcgcctc accggcctct tcgacgggcg gagcgcgctg       840
     gagctcgccg ccgcccatcc cgccgacgcg gcgacgatcc tgcgcgtcgc gctgctcctc       900
     gccgaggcgg agctgctcgc gttcggagcg gcgcgcgcct cgccgccccg cgcggtcccg       960
     ggcgcgagcg cgtccgcgtc ctccgccgcg gccgcgcagc cgacctcgac cccgaccgcg      1020
     ccgcgaaacc ctgaggccgg tcacccttcc gcggcctccg gccgcgacgc tcaggacagg      1080
     ccgcgcgtcg cgtcctccgc cgcggcgcga gccccgacct cgaccccgac cgcgggagcg      1140
     cgaacggccg ctcatcccga gcgtagcgcc gccgcggcag cggcggagcg agctcgaggg      1200
     acgccacccg ttcccgtcga tcccgccacg ctgcgtgcgc tcctccagcg gctcgcggcc      1260
     gccgaccact tcgaggtcct cggcgtgaag cgcgacgccg ccccggcgca ggtgaaggtc      1320
     gcctacttcc ggctcgcgaa gagctatcac ccggacgcgg tgcccgcctc cgtctccgcg      1380
     gaggtccgcg gcctctgcgc cgacgtgttc gccaaggtga gcgccgcctg ggccgtgctc      1440
     ggcgacgacg cgcagcgcgc gaagtacctg gacgagctcg cctccggcgg cgcagcggac      1500
     gtggacgtga tgcggatcct ccaggcggag aacgtgttcc aggcgggcac ggtcctcgtg      1560
     cgggcacgcc gctacgcgga ggcgctcgag aagttccgcg acgcggcggt cctcaacgag      1620
     gacgagccgg agttcgcgat ctggctcgcg tggtgcgagt tcctcgtcgc gaaggagccg      1680
     cgggcgcagc acgccgcgag cgccgccgcc atcgaggacg ggctgcgccg gaacgcgcgc      1740
     tgcgcgccgg ggtacctgtt cctcgcccag atggccaaga tcgtggggga cctctccctc      1800
     gcggagcgcc atctccgccg cggcctcgcg gtcgcgccgg agcacgtgga cctcgtccgc      1860
     gagctccgct acctcaggaa gtga                                             1884
//

If you have problems or comments...

PBIL Back to PBIL home page