(data stored in ACNUC7421 zone)

EMBL: CP000769.PE281

CP000769.PE281       Location/Qualifiers
FT   CDS_pept        331737..332243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0283"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   ade:Adeh_0261 protein of unknown function UPF0044"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24501"
FT                   /db_xref="GOA:A7H705"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:A7H705"
FT                   /protein_id="ABS24501.1"
FT                   /translation="MPAPTNPKKRALMPSTRLRKTLRAAGHHLSPVVQVGKEGVTEAVL
FT                   RQLDEALSAHELVKVKIGTETPEDRFEAADRLGADSGAQVAQILGRTILVYRRHPEKPR
FT                   YEAPTARPALKELESPAPRTRGKARRSPARGAKGPARGAKPGRGAKGAARGAKPARGAA
FT                   RTRSR"
     atgcccgcac cgacgaaccc gaagaagcgc gccctcatgc cctcgacccg gctccgcaag        60
     acgctccgcg cggccgggca ccacctctcg cccgtcgtgc aggtcgggaa ggagggggtc       120
     accgaggcgg tcctgcgcca gctcgacgag gcgctctccg cgcacgagct cgtgaaggtg       180
     aagatcggca cggagacccc cgaggatcgc ttcgaggcgg cggaccggct cggcgcggac       240
     agcggcgcgc aggtggcgca gatcctcggc cgcacgatcc tggtgtaccg ccggcacccg       300
     gagaagccgc gctacgaggc ccccaccgcg cgccccgcac tgaaggagct ggagagcccc       360
     gcgccccgca cccgcggcaa ggcccgccgc tccccggcgc gcggcgcgaa ggggccggcg       420
     cgcggcgcga agcctgggcg cggcgcgaag ggggcggcgc gcggcgcgaa gcccgcgcgc       480
     ggcgcggcgc ggacgcggtc caggtag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page