(data stored in ACNUC7421 zone)

EMBL: CP000769.PE285

CP000769.PE285       Location/Qualifiers
FT   CDS_pept        complement(335563..336018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0288"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0266 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24505"
FT                   /db_xref="GOA:A7H709"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H709"
FT                   /protein_id="ABS24505.1"
FT                   /translation="MGMALGTKKPASDINVTPLIDVVLVLLIIFMVLTPLAEKQKFMRV
FT                   PDYQPEMQPVPPDSVPPDQTILTALRNGNVLLNKQELSVADAMQRLGPAYEGRPSKVLF
FT                   FNAEDNVKYDQVVYVLDQAHGAGVNTIGMMTDPPLTAQAAPAEAAPQ"
     atggggatgg cgctcgggac caagaagccc gcctcggaca tcaacgtcac gccgctcatc        60
     gacgtggtgc tggtgctgct catcatcttc atggtgctga cgccgctcgc cgagaagcag       120
     aagttcatgc gcgtcccgga ctaccagccc gagatgcagc cggtcccgcc ggactcggtg       180
     ccgccggatc agacgatcct gacggcgctg cgcaacggga acgtgctcct gaacaagcag       240
     gagctgagcg tcgcggacgc gatgcagcgg ctcggccctg cgtacgaggg ccgcccctcc       300
     aaggtgctgt tcttcaacgc cgaggacaac gtcaagtacg accaggtggt gtacgtgctc       360
     gaccaggcgc acggagcggg cgtgaacacg atcgggatga tgaccgatcc gcccctcacc       420
     gcgcaggccg caccggcgga ggcggccccg cagtag                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page