(data stored in ACNUC7421 zone)

EMBL: CP000769.PE286

CP000769.PE286       Location/Qualifiers
FT   CDS_pept        complement(336021..336434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0289"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   ade:Adeh_0267 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24506"
FT                   /db_xref="GOA:A7H710"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A7H710"
FT                   /protein_id="ABS24506.1"
FT                   /translation="MSMDVGSKSVKSDINVTPLVDVVLVLLIIFMVITPMLQRGKPVQL
FT                   PDAKHVSALKGGGDPVLLSITADGKAWIDKAEVPLDQLSTELTVAMQMSPGSPVMIKGD
FT                   KSLDYKKVREIILEVSKTHLLGVSLAASEIKEK"
     atgtcgatgg atgtcggcag caagtcggtg aagagcgaca tcaacgtgac gccgctcgtc        60
     gacgtcgtgc tggtgctcct catcatcttc atggtcatca ccccgatgct gcagcgcgga       120
     aagccggtcc agctccccga cgccaagcac gtctccgcgc tgaagggcgg cggcgatccg       180
     gtcctcctct ccatcaccgc cgacgggaag gcctggatcg acaaggcgga ggtcccgctc       240
     gatcagctct ccaccgagct caccgtggcg atgcagatgt cgccgggctc tccggtgatg       300
     atcaagggcg acaagagcct cgactacaag aaggtccgcg agatcatcct cgaggtctcg       360
     aagacgcacc tgctcggcgt gagcctcgcc gccagcgaga tcaaggagaa gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page