(data stored in ACNUC7421 zone)

EMBL: CP000769.PE289

CP000769.PE289       Location/Qualifiers
FT   CDS_pept        338542..341871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24509"
FT                   /db_xref="GOA:A7H713"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A7H713"
FT                   /protein_id="ABS24509.1"
FT                   /translation="MRKKLLRFLRLAPLALLFASTASAQTTGTILGVVTDASTGKPVAG
FT                   AVIIATSPSLQGEQTAVTDNNGSFRLPQLPPGDYKLAVQLDGYKPAERSDITVRLDKTI
FT                   RANLAVVPEAVQMEEQVVRTGAAPVINIGAAESGAVISREFVASVPVGRTVEAVSATVP
FT                   TASVDQYGVGFAGSQSPENAYILDGMNVTDPVYGTFGGNPTAQNPQTTLITNFIQEVDV
FT                   KTGGFMPEYGRATGGVLNMVAKSGSNEFHGSVFGNLTPRFLFQPTGRTAGAAGEAVAWR
FT                   FKPDEGSYDLDLGFEIGGPIQKDKLWFYAGFAPVITKRNTERFLRSNVLGDVGTGNCAV
FT                   EDPLELGRCIDSNGNFVQNTIPGTSEIIESGRSTYQFTGKLTYLLNENNNFTLSGFGLP
FT                   STEKRYAMNGAEQRRTIESTDNIFDVIGRYSGKFLDKRLITEVVAGWHGSTSVDDPSSF
FT                   QASNSAIEWYDNLPLSGFEGDRPGVDAACNTADPLASCTVFGYLTGGSGFLNDSAANRL
FT                   AGRVNATYLFDAFGSHATKGGLDVERSTYGITKRYGGGAYFRAVPNATGTDASLRVFRG
FT                   YGVVNNGTPSDTFGVIAEPGALIGPDGINQFESIETNSQTTSTALYLQDSWQLPIQNVT
FT                   LNYGLRWEMQDMSNRDNPEDNGFTISNNWAPRVQAIWDFTGNGRGKLAGSWGRFYYMMP
FT                   LDMGDRAFGLEDNLRYRLTASTCGNWAQSGAVGNYAAFDATQVGLGRSTCEIETRTAAG
FT                   ETFDAFQSGGFTPVDPNLDATYVDQFGGQLEYEVLSDLSLGLEYQGRRQGATIEDMSSD
FT                   DGVHYYIGNPGTGSPFTIDGVTYDPVNVTTFDVMTGREVNVKFPEPERSYDAITVFGRK
FT                   NFSQNWQAFASYTYSYLRGNLAGPYREEDGQIDPGITSEYDLASLMANKHGRLPGDRPH
FT                   QVKLYGSYTFNFGPRFNLTTGAGYTGTSGNPVNALGADGGAGDYGEGQAFILPRGMAGR
FT                   SPFLHNVDLKGSLSYVITPPYALQFSVDVFNVFNTEEVRLTDENYTFDAVQPIVGLNCD
FT                   TSAGGSSNPVAKLQADCSDVRYLKTVDGRPVSVNPNWGKAAPGVNSFQAPLSLRFGVAL
FT                   SF"
     atgaggaaga agttgctgcg cttcctgcgg ctcgcgccgc tcgcgctgct gttcgcgagc        60
     actgcgtccg cgcaaaccac cggcaccatc ctcggcgtgg tgaccgatgc gtcgaccgga       120
     aagccggtcg ccggcgccgt catcatcgcc acgagccctt cgctgcaggg cgagcagacg       180
     gcggtgacgg acaacaacgg ttccttccgt ctcccgcagc tgccgccggg tgactacaag       240
     ctcgcggtcc agctcgacgg ctacaagccg gccgagcggt ccgacatcac ggtgcgcctc       300
     gacaagacca tccgcgcgaa cctcgcggtc gtccccgagg ccgtccagat ggaggagcag       360
     gtcgtgcgca cgggcgcggc gccggtcatc aacatcggcg cggccgagag cggcgcggtc       420
     atctcccgcg agttcgtggc gagcgtcccc gtcggccgca cggtcgaggc cgtctcggcg       480
     acggtgccga ccgcgtccgt cgaccagtac ggcgtcggct tcgccggctc gcagtcgccc       540
     gagaacgcct acatcctcga cggcatgaac gtgacggacc cggtgtacgg cacgttcggc       600
     ggcaacccga ccgcgcagaa cccgcagacg accctcatca cgaacttcat ccaggaggtc       660
     gacgtcaaga ccggcggctt catgccggag tacggccgcg ccacgggcgg tgtgctcaac       720
     atggtcgcga agtcgggctc gaacgagttc cacggctcgg tgttcggcaa cctgaccccg       780
     cgcttcctgt tccagccgac gggccgcacg gccggtgcgg ccggtgaggc ggtggcgtgg       840
     cggttcaagc cggacgaggg ctcctacgac ctcgacctcg gcttcgagat cggcggcccc       900
     atccagaagg acaagctctg gttctacgcc ggcttcgcgc cggtcatcac gaagcgcaac       960
     acggagcggt tcctccgctc caacgtgctc ggtgacgtcg ggacggggaa ctgcgcggtg      1020
     gaggatccgc tcgagctcgg ccgctgcatc gactcgaacg gcaacttcgt ccagaacacg      1080
     atcccgggca cgagcgagat catcgagagc ggccggagca cctaccagtt caccggcaag      1140
     ctcacctacc tgctgaacga gaacaacaac ttcacgctct ccgggttcgg cctgccgtcc      1200
     accgagaagc gctacgcgat gaacggcgcc gagcagcgcc gcaccatcga gagcaccgac      1260
     aacatcttcg acgtgatcgg ccgctactcc ggcaagttcc tcgacaagcg gctcatcacc      1320
     gaggtcgtcg ccggctggca cggctccacc tccgtggacg atccgtcctc gttccaggcc      1380
     agcaactccg cgatcgagtg gtacgacaac ctcccgctct ccgggttcga gggtgatcgc      1440
     cccggcgtgg acgccgcctg caacacggcg gacccgctcg cgagctgcac ggtgttcggc      1500
     tacctcaccg gcggctccgg cttcctgaac gactcggccg cgaaccgcct ggcgggccgc      1560
     gtgaacgcca cctacctgtt cgacgccttc ggctcccacg ccacgaaggg cggcctcgac      1620
     gtcgagcgct ccacctacgg gatcacgaag cgctacggcg gcggcgccta cttccgcgcc      1680
     gtccccaacg ccaccgggac ggacgccagc ctccgcgtgt tccgcggcta cggcgtcgtc      1740
     aacaacggca cgccgagcga caccttcggc gtcatcgccg agccgggagc cctgatcggc      1800
     cctgacggca tcaaccagtt cgagagcatc gagacgaact cgcagacgac gtccaccgcg      1860
     ctctacctgc aggactcgtg gcagctcccc atccagaacg tgacgctgaa ctacggtctc      1920
     cgctgggaga tgcaggacat gtccaaccgg gacaacccgg aggacaacgg gttcacgatc      1980
     tcgaacaact gggcgccgcg cgtccaggcg atctgggact tcaccgggaa cggccgcggc      2040
     aagctggccg gcagctgggg ccgcttctac tacatgatgc cgctcgacat gggcgaccgc      2100
     gccttcggcc tcgaggacaa cctccgctac cgtctgacgg cttcgacgtg cggtaactgg      2160
     gcccagtcgg gcgccgtggg caactacgcc gcgttcgacg cgacgcaggt cggcctcggc      2220
     aggagcacct gcgagatcga gacccgcacc gccgccggcg agacgttcga cgcgttccag      2280
     tcgggcggct tcacgccggt cgatccgaac ctcgacgcga cctacgtcga ccagttcggc      2340
     ggccagctcg agtacgaggt gctctccgac ctctcgctcg gcctcgagta ccagggccgt      2400
     cgccagggcg cgacgatcga ggacatgtcc tccgacgacg gcgtccacta ctacatcggc      2460
     aacccgggca ccggcagccc gttcacgatc gacggggtga cctacgatcc ggtcaacgtg      2520
     accacgttcg acgtgatgac gggccgcgag gtcaacgtga agttccccga gcccgagcgc      2580
     tcgtacgacg cgatcaccgt cttcgggcgg aagaacttct cccagaactg gcaggccttc      2640
     gcgagctaca cctactcgta cctgcgcggt aacctcgccg gcccgtaccg cgaggaggac      2700
     ggccagatcg acccgggcat cacctccgag tacgacctcg cctccctcat ggcgaacaag      2760
     cacggtcgac tccccggcga ccgtccgcac caggtgaagc tgtacggctc gtacaccttc      2820
     aacttcgggc cgcggttcaa cctcaccacc ggcgcggggt acaccggcac ctccggaaac      2880
     cccgtcaacg cgctcggcgc cgacggcggc gcgggcgact acggcgaggg ccaggcgttc      2940
     atcctcccgc gcggcatggc ggggcgctcg ccgttcctcc acaacgtcga cctcaagggc      3000
     tcgctcagct acgtcatcac gccgccgtac gcgctccagt tctcggtgga cgtgttcaac      3060
     gtcttcaaca ccgaggaggt ccggctgacg gacgagaact acacgttcga cgccgtccag      3120
     ccgatcgtcg gcctgaactg cgacacgagc gccggcggct cgagcaaccc ggtcgcgaag      3180
     ctccaggccg actgctccga cgtgcggtac ctcaagaccg tcgacggccg tccggtgagc      3240
     gtcaacccga actggggcaa ggccgccccg ggcgtcaact cgttccaggc gccgctctcg      3300
     ctgcgcttcg gcgtcgccct ctcgttctag                                       3330
//

If you have problems or comments...

PBIL Back to PBIL home page