(data stored in ACNUC7421 zone)

EMBL: CP000769.PE290

CP000769.PE290       Location/Qualifiers
FT   CDS_pept        341894..343552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24510"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A7H714"
FT                   /protein_id="ABS24510.1"
FT                   /translation="MNSIRKLWWVGAVAIIAACDPYDDENKGPPSILSAFASNADEAAE
FT                   GELVDGFWTIRSSSVCEGAHLAPRGVVPRGASAEASTIADIPVVYVKTNKLLDGASIQA
FT                   DPLSCDPAVRDGAPWLKVTRVVGATETDDSANWLSCYNPSSPTSSEGASIIIYRGEDVS
FT                   GGVAGDGWFAVSEVEGDAAEVATYRIEGTVFDRQGNALPVNVAFELEPDAGPIKSFRAT
FT                   ELAGSGDAVTANFEFTPGACGSATEYVVQKVTGKDADGDPIWTALEGATFTVADPPATT
FT                   YSFTDTVTAGEVYDYRIRATVPGVGEEFTETAGEYTLTALEIPAGAPTAAFLPAEGTGT
FT                   AAKPNRISVNTSATALPAGASAFVVLRATEDESIATEDLPGAFSVVAPEVGLAGSTTEA
FT                   KFPFEDTKLSGCQQYFYALAVTDADGNVGPYGDPSPGVKSPVAKVAAPTLEAVTAGGVK
FT                   VTWKILRGALTYDVQRAPDAAGVPGTYETIAANVAQPANPVDPTAKAVTTANVTDATAA
FT                   AGTKYHYRVNVATSDSTLCSDVVTTSTGTAASITR"
     atgaacagca tcaggaaact gtggtgggtc ggagcggtgg cgatcatcgc cgcctgcgat        60
     ccgtacgacg acgagaacaa ggggccgccc tcgatcctct cggccttcgc ctcgaacgcc       120
     gacgaggcgg ccgagggcga gctggtcgac gggttctgga cgatccgctc ctcgtccgtc       180
     tgcgagggcg cgcacctcgc gccccgcggc gtcgtgcctc gcggcgcgtc ggcggaggcg       240
     tcgacgatcg ccgacatccc ggtcgtctac gtgaagacca acaagctcct cgacggggcc       300
     tcgatccagg cggatccgct gagctgcgat ccggccgtcc gcgacggcgc gccgtggctc       360
     aaggtgaccc gcgtggtggg cgcgacggag acggacgact cggccaactg gctgagctgc       420
     tacaacccgt cgtctccgac ctcctcggag ggcgcgtcga tcatcatcta ccgcggcgag       480
     gacgtctcgg gcggcgtcgc tggggacggc tggttcgccg tcagcgaggt cgagggcgac       540
     gcggccgagg tcgccaccta ccgcatcgaa ggcaccgtct tcgatcggca gggcaacgcg       600
     ctcccggtga acgtcgcgtt cgagctcgag ccggacgccg gcccgatcaa gtccttccgc       660
     gcgaccgagc tcgccggctc gggtgacgcc gtcaccgcca acttcgagtt cacgcccggc       720
     gcctgcggca gcgcgaccga gtacgtggtg cagaaggtca cgggcaagga cgcggacggc       780
     gacccgatct ggacggccct cgaaggcgcg acgttcacgg tcgcggatcc gcccgcgacg       840
     acgtactcct tcaccgacac cgtcacggcc ggcgaggtct acgactaccg gatccgcgcg       900
     acggttccgg gcgtgggcga ggagttcacc gagaccgccg gcgagtacac gctcacggcc       960
     ctcgagattc ccgctggggc gccgacggcc gccttcctgc cggccgaagg tacgggcacg      1020
     gctgcgaagc cgaaccggat ctcggtgaac acgagcgcga ccgctctccc cgcgggtgcc      1080
     agcgccttcg tggtcctccg ggccacggag gacgagtcca tcgcgacgga ggatctgccg      1140
     ggcgcgttct cggtggtcgc tcccgaggtc ggcctcgccg gctcgacgac cgaggcgaag      1200
     ttcccgttcg aggacaccaa gctcagcggc tgccagcagt acttctacgc gctggcggtc      1260
     acggacgccg acggcaacgt cggcccctac ggtgacccct cgcccggcgt caagtcgccg      1320
     gtcgccaagg tcgctgcgcc gacgctcgag gccgtgaccg cgggcggcgt gaaggtgacg      1380
     tggaagatcc tccgcggcgc cctcacgtac gacgtgcagc gcgcgccgga cgccgctggc      1440
     gtgccgggca cctatgagac catcgctgcg aacgtcgctc agcccgccaa tccggtggat      1500
     ccgacggcga aggcggtcac gacggcgaac gtcacggacg cgaccgcggc ggccgggacg      1560
     aagtaccact accgcgtgaa cgtcgcgacg agcgactcca cgctctgcag cgacgtggtc      1620
     acgacgagca cgggcaccgc cgcctccatc acgcggtaa                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page