(data stored in ACNUC7421 zone)

EMBL: CP000769.PE292

CP000769.PE292       Location/Qualifiers
FT   CDS_pept        complement(344541..345488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0295"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: ade:Adeh_0273
FT                   ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24512"
FT                   /db_xref="GOA:A7H716"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H716"
FT                   /protein_id="ABS24512.1"
FT                   /translation="MASALTTQGTAITMKQLLEAGVHFGHQTKRWNPKMKPYIFGARNG
FT                   IYIIDLQKTVGLARGALRFVSDAVAKGGMVLFVGTKKQAQDAIREEASRSGQYHVTNRW
FT                   LGGTLTNFKTVKQGIDRLKTIEKMAADGTYERLPKKEVAQLEREREKLEKNLGGIKEMS
FT                   RLPAAIFVIDTKKEHIAVHEANRLGIPVVAVVDTNCDPEGIEYVIPGNDDAIRSIRLFT
FT                   GKIAEACIEGRARYSTWAAQHGEERRPGEEDRDAASERGQKDRRDRRDRRGGGRDRERR
FT                   EPREDRAAASANVEVVRKGEVTPAQPAPGSDANR"
     atggcgagcg ccctcacgac gcagggcacc gccatcacga tgaagcagct cctcgaggcg        60
     ggcgtccact tcggccacca gacgaagcgc tggaacccga agatgaagcc gtacatcttc       120
     ggcgcccgca acggcatcta catcatcgac ctccagaaga ccgtcggcct cgcgcgcggc       180
     gcgctccgct tcgtctcgga tgcggtcgcg aagggcggca tggtcctctt cgtcggcacg       240
     aagaagcagg cccaggacgc catccgcgag gaggcctccc gctccggcca gtaccacgtc       300
     acgaaccgct ggctcggcgg cacgctcacg aacttcaaga ccgtgaagca gggcatcgac       360
     cggctgaaga ccatcgagaa gatggcggcg gatggcacct acgagcggct tcccaagaag       420
     gaggtcgccc agctcgagcg cgagcgcgag aagctggaga agaacctcgg cggcatcaag       480
     gagatgagcc gcctgcccgc cgcgatcttc gtcatcgaca cgaagaagga gcacatcgcg       540
     gtgcacgagg cgaaccggct cggcatcccg gtggtcgcgg tcgtcgacac gaactgcgat       600
     cccgagggca tcgagtacgt catccccggc aacgacgacg cgatccgctc catccgcctc       660
     ttcaccggca agatcgccga ggcctgcatc gagggccgcg cccgctactc cacctgggcc       720
     gcgcagcacg gcgaggagcg gcgtccgggc gaggaggatc gtgacgccgc gagcgagcgc       780
     gggcagaagg accgccgcga tcgccgcgac cgccggggag gcgggcgtga ccgcgagcgc       840
     cgcgagccgc gcgaggaccg cgccgccgcg agcgcgaacg tcgaggtcgt ccgcaagggc       900
     gaggtgacgc cggcgcagcc cgcgcccggc agcgacgcca accgctag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page