(data stored in ACNUC7421 zone)

EMBL: CP000769.PE296

CP000769.PE296       Location/Qualifiers
FT   CDS_pept        349883..351298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24516"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:A7H720"
FT                   /protein_id="ABS24516.1"
FT                   /translation="MALPFARESSPEARAAPEAALAAAPDGQPRRFDGWPGGAGLSVSA
FT                   VCAALVALTVHADVDAEWRLHARKWVDADKVLCGIGETSDDVPAHLGRREEAGKELRAA
FT                   RPSNRDVEAALRGSSRPDRLLASAAIAVIGDASDAQVDGLTRQVQDPDPYARLLAVRAL
FT                   RSASAEQVGKRATALVAALVREQNGAVLLEAIPLLEGMDSSDATPVFGHMFELPDDGLH
FT                   AYAYAMLERLGRPSLESVERYVEQRGSAPARDALRGSDWLRAANQYVDSYRSYYLGGHN
FT                   GMDDFGALKSAGERLARRVPRESVLREALFHHDALKRAAALAALSVARSTNGDLVPRLI
FT                   HLMRHERDPVMRGFAADALRAAPEDVVRKNARGVIEALSDESDVHVVVAESFLAMRLDP
FT                   EAAVEAIAMLSIRGDNTLRRVLHAQLHNIGGPPAVERAAQMLGRLGKTEAAAELREIEK
FT                   EREERDRAKRRGD"
     atggcccttc cgttcgcgcg cgagagcagt cccgaggcgc gagccgcgcc ggaggctgcg        60
     ctcgctgcgg cgcccgacgg gcaacctcga agattcgacg gatggccagg gggcgcgggc       120
     ttgagcgtat cagcggtctg cgcggcactg gtcgcgctga cggtgcatgc cgatgtggac       180
     gccgagtggc gtctccatgc tcggaaatgg gtcgacgcag acaaggtgct gtgcgggatc       240
     ggcgagactt ccgacgacgt gcccgctcac ttggggcgcc gggaagaggc cggaaaggaa       300
     ttgcgagctg cgcgaccgtc caatcgcgac gtcgaagccg cactccgcgg ctcgtcgcgg       360
     cctgaccggc tgctcgcgag cgccgcgatc gcggtgatcg gcgatgcatc ggatgcgcag       420
     gtggacgggc tcacgcgcca ggtgcaggac cccgatccgt acgcgcgctt gctggcggtg       480
     cgtgcgttgc ggagcgcttc ggccgagcag gtcgggaagc gcgcgacggc gctggtggct       540
     gcgctcgtgc gcgagcagaa cggggccgtg ctgctggagg ccattccgct gctcgaaggg       600
     atggattcat cggacgcgac gccggtgttc ggacacatgt tcgagctgcc ggatgatggg       660
     ctgcatgcgt acgcgtacgc gatgctcgag cgtctgggtc gaccgtcgct cgagagcgtg       720
     gagcgctacg tcgagcagcg ggggagtgcg ccggcacggg atgcgctgcg cgggagtgat       780
     tggttgcggg cagcgaacca atatgtggat tcgtacaggt cgtattactt gggcgggcac       840
     aatgggatgg acgacttcgg cgcgctgaag tccgcaggcg aacgactcgc acgccgcgtt       900
     ccacgcgagt ccgtcctcag ggaggcgctc ttccatcacg acgcgctgaa gcgcgctgcc       960
     gctctggcgg ccctgtccgt cgcgagatct acgaacggcg atctggtccc ccgtctcatc      1020
     catctgatga ggcacgagcg agatcccgtc atgcgtggct ttgcagcgga cgcgctcagg      1080
     gccgcgcccg aggatgtcgt gcggaagaac gcgagaggcg tcatcgaggc gctctcggac      1140
     gagtcggacg ttcacgtcgt ggtcgcagaa tcgttcctgg cgatgcggct cgaccccgag      1200
     gcggcggtcg aggccatcgc gatgctgtcc atccgtggag acaacacgct caggcgagtg      1260
     ctgcacgctc aacttcacaa catcggaggc ccccctgccg tcgagcgagc cgcccagatg      1320
     ctcgggcggc tcgggaagac ggaggccgcg gccgagctga gggagatcga gaaggagcgg      1380
     gaggaacggg accgagccaa gagacgcgga gactag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page