(data stored in ACNUC7421 zone)

EMBL: CP000769.PE297

CP000769.PE297       Location/Qualifiers
FT   CDS_pept        351376..351579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24517"
FT                   /db_xref="UniProtKB/TrEMBL:A7H721"
FT                   /protein_id="ABS24517.1"
FT                   /translation="MPRCCKRQSRPRVSVVRSCFGEVGLLLEAPRPRGPDQFLDALVAR
FT                   AINASLGRWEAFWAPNSYSAVA"
     atgccaaggt gctgtaagag gcagtcgcgc cctcgggtca gcgtcgtgcg gtcgtgtttc        60
     ggagaagttg ggctgttgtt ggaggccccg aggccccgag gcccggacca gttcctggat       120
     gcgctggtgg cgcgcgcaat caacgcgtcg ttgggccggt gggaagcgtt ctgggcgccc       180
     aacagctaca gcgccgtggc gtga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page