(data stored in ACNUC7421 zone)

EMBL: CP000769.PE30

CP000769.PE30        Location/Qualifiers
FT   CDS_pept        complement(38391..39773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0030"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: mxa:MXAN_0336
FT                   sensory box histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24250"
FT                   /db_xref="GOA:A7H6A4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A4"
FT                   /protein_id="ABS24250.1"
FT                   /translation="MPSRPVAGFVAAITAIVLALAVYLAVAISRQANAARAAESTRAVL
FT                   ALERLDASMREAESSHRGYLLDGSAAELARHERAVSEIRAHLAALTARAEREPALRART
FT                   EALVAGADAALATMRAERDARDGALVGGAPWHAVADPGLLDGMDRVRAGLVAVERDALE
FT                   RREQAWSGKTALGDAVFLVANLALAAVLLFAATSVRRALAAHEARERERHVALEAQARM
FT                   FGIVGHDLRTPLSAIEAGATLLSRRSLAPAEARTLARILASSRRMARMIGDLLDFTRVR
FT                   DAGGIPLAPRATDLREVCRPVVEEVRLRHGADAVALSLDGHLDGNWDPDRLQQAIGNLV
FT                   SNALQHQPTGAPVRLRAIGDHDAVCVEVENDGPPIPAEAARAIFEPFRRGDARQAGADG
FT                   LGLGLFIVRTIVEAHGGNVEVASGPDRPTTFTVRLPRGRPRERHAWAGSGLKAPAPPFD
FT                   AG"
     gtgcccagcc gacccgtcgc cggtttcgtc gccgccatca ccgccatcgt gctggcgctg        60
     gccgtgtacc tcgcggtcgc gatctcgcgc caggcgaacg ccgcgcgcgc cgcggagtcg       120
     acgcgggcgg tgctcgccct cgagcggctc gacgcctcga tgcgggaggc ggagagcagc       180
     caccggggat acctgctcga cgggagcgcc gcggagctcg cccggcacga gcgcgcggtg       240
     tcggagatcc gcgcgcacct cgcggccctc acggcgcgcg ccgagcggga gcccgcgctc       300
     cgcgcgcgca ccgaggcgct cgtcgccggc gccgacgccg cgctcgcgac catgcgcgcc       360
     gagcgggacg cgcgagacgg cgcgctggtc ggcggcgcgc cctggcacgc cgtggcggac       420
     cccggcctgc tcgacgggat ggaccgcgtg cgcgccgggc tcgtcgcggt cgagcgcgac       480
     gccctcgagc gccgggagca ggcctggtcg ggcaagacag ccctcgggga cgccgtgttc       540
     ctcgtcgcga acctggcgct cgcggcggtg ctgctgttcg cggcgacgag cgtccgccgc       600
     gcgctcgccg cgcacgaggc gcgggagcgc gagcggcacg tcgccctcga ggcgcaggcg       660
     cgcatgttcg gcatcgtggg ccacgacctg cggaccccgc tctccgcgat cgaggcgggc       720
     gcgaccctcc tctcgcgccg ctcgctcgcg ccggccgagg cgcgcaccct cgcccgcatc       780
     ctggcgagct cccggcgcat ggcgcggatg atcggcgacc tgctcgactt cacgcgggtg       840
     cgcgacgcgg gcggcatccc gctcgcgccg cgtgccaccg acctgcgcga ggtgtgccgg       900
     ccggtcgtcg aggaggtgcg gctgcggcac ggcgccgacg ccgtcgccct ctcgctcgac       960
     gggcacctcg acgggaactg ggaccccgac cggctccagc aggcgatcgg gaacctcgtg      1020
     tcgaacgcgc tccagcacca gcccaccggc gccccggtgc ggctgcgcgc catcggcgac      1080
     cacgacgccg tctgcgtgga ggtcgagaac gacgggccgc ccatcccggc cgaggccgcg      1140
     cgcgccatct tcgagccctt ccggcgcggc gacgcccggc aggccggcgc ggacggcctc      1200
     ggcctcgggc tgttcatcgt gcggaccatc gtggaggcgc acggcgggaa cgtggaggtc      1260
     gcgtcggggc cggaccgccc caccaccttc accgtccggc tgccgcgcgg gcgcccgcgg      1320
     gagcggcacg cctgggcggg ctccggcctg aaagcgccgg cgccgccgtt cgatgcaggg      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page