(data stored in ACNUC7421 zone)

EMBL: CP000769.PE300

CP000769.PE300       Location/Qualifiers
FT   CDS_pept        354714..355463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0304"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: ade:Adeh_0280
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24520"
FT                   /db_xref="GOA:A7H724"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7H724"
FT                   /protein_id="ABS24520.1"
FT                   /translation="MPSDRAATPKPSYKRILLKLSGEALMGDGKYGISPKTLSAIAGDV
FT                   KDCVDLGVEVALTIGGGNIFRGVSGATEGMDRSSADYMGMLATVINAMALQDALEKIGV
FT                   NTRVQSAIEMHQVAEPYIRRRAIRHLEKGRVVIFAAGTGNPYFTTDTAASLRAMEIHAD
FT                   VLLKATKVDGVYTDDPKKNPAATKFKQLSYIDVLKKNLKVMDSTAISLCMDNDLPIIVF
FT                   DSTLRGNVRRVVLGEQIGTTVGRLEEK"
     atgccgagcg accgagccgc gacgccgaag cccagctaca agcgcatcct cctcaagctg        60
     tcgggcgagg cgctcatggg cgacggcaag tacggcatct cgccgaagac cctctccgcc       120
     atcgccggcg acgtgaagga ctgcgtcgat ctcggcgtcg aggtcgcgct caccatcggc       180
     ggcggcaaca tcttccgcgg cgtgtccggg gcgacggagg gcatggaccg ctcctccgcc       240
     gactacatgg gcatgctcgc caccgtcatc aacgcgatgg cgctgcagga cgcgctcgag       300
     aagatcggcg tgaacacgcg ggtgcagtcg gccatcgaga tgcaccaggt cgccgagccc       360
     tacatccgcc gccgcgccat ccgccacctc gagaagggcc gggtggtgat cttcgcggcg       420
     ggcaccggca acccgtactt cacgaccgac accgccgcct ccctccgcgc gatggagatc       480
     cacgcggacg tgctgctcaa ggcgaccaag gtcgacggcg tctacacgga cgatccgaag       540
     aagaacccgg ccgccaccaa gttcaagcag ctcagctaca tcgacgtcct gaagaagaac       600
     ctgaaggtga tggactcgac ggccatcagc ctctgcatgg acaacgacct gccgatcatc       660
     gtgttcgact cgacgctgcg cgggaacgtt cgccgcgtcg tgctgggcga gcagatcggg       720
     accacggtcg gccggctcga ggagaagtag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page