(data stored in ACNUC7421 zone)

EMBL: CP000769.PE306

CP000769.PE306       Location/Qualifiers
FT   CDS_pept        complement(358058..358393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24526"
FT                   /db_xref="UniProtKB/TrEMBL:A7H730"
FT                   /protein_id="ABS24526.1"
FT                   /translation="MIVVAVRDLLFRSKITSAAERLAVPILLAPRDRPLGDVVRETAGA
FT                   SVLADLNQPGMVEELAALKRDTGARVVGFLGHLQADLIEAAEAAGVDEVMTRGQLTGRL
FT                   DEVLRRG"
     atgatcgtcg tcgccgtccg ggacctgctc ttccgctcca agatcacctc cgccgccgag        60
     cggcttgcgg tgcccatcct gctcgcgccc cgcgaccggc cactcgggga cgtggtccgt       120
     gagaccgcgg gtgcgagcgt gctcgcggac ctcaaccagc ccggcatggt ggaggagctc       180
     gcggcgctca agcgggacac cggcgcgcgc gtggtgggat tcctgggcca ccttcaggcg       240
     gatctcatcg aggccgccga ggcggccggg gtggacgagg tgatgacgcg cggtcagctc       300
     accggccggc tcgacgaggt gctgcggcgc gggtga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page