(data stored in ACNUC7421 zone)

EMBL: CP000769.PE308

CP000769.PE308       Location/Qualifiers
FT   CDS_pept        360393..361358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0312"
FT                   /product="ABC-type Fe3+ transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: ade:Adeh_0287 ABC-type Fe3+ transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24528"
FT                   /db_xref="UniProtKB/TrEMBL:A7H732"
FT                   /protein_id="ABS24528.1"
FT                   /translation="MTASPRRRVLAVLPLALALACSRPARTLPEVKVHVASDLPAEVLA
FT                   DVAARFGVAKVVPVAAAADAELAWVGDPAQALALGERLVAGSAPAAEDVPARWRDPKRR
FT                   FAPLGARARVLLVSPAARLPFSPSNLRDLADPRARGRISVVPFGRGAGPVTIAALVLAY
FT                   GGESAGRFLSLVARNEPQLADADAEVRARVASGQATFGLAGSLEGAAAAASATPLEVVY
FT                   PDQLGSGAVALPTAVALLGGASDAARALAAWLAGPDAERVLVARIPGLLPLRAEVPVPV
FT                   GVEPAGNIVSLPFDWDALAAETGKQRARLERWPEGFTERK"
     atgaccgcgt ccccgcgccg ccgcgtcctc gccgtgctcc cgctcgcgct cgcgctcgcc        60
     tgctcgcgcc cggcccggac gctccccgag gtgaaggtcc acgtcgcctc cgacctgccc       120
     gccgaggtgc tcgccgacgt ggccgcgcgg ttcggggtgg cgaaggtggt ccccgtggcc       180
     gccgccgcgg acgccgagct cgcctgggtc ggggatcccg cccaggccct cgcgctcggc       240
     gagcggctcg tcgccggcag cgcccccgcc gccgaggacg tcccggcgcg ctggcgcgat       300
     ccgaagcgcc gcttcgcacc gctcggagcc cgcgcgcgcg tgctgctcgt ctcccccgcc       360
     gcgcgactgc cgttctcgcc ctcgaacctc cgcgatctcg ccgacccgcg cgcgcgtggg       420
     cggatctcgg tggtcccgtt cggccgcggc gcgggaccgg tcaccatcgc cgcgctcgtg       480
     ctcgcctacg gtggcgagag cgcgggccgc ttcctctcgc tcgtcgcccg caacgagccg       540
     cagctcgcgg acgcggacgc cgaggtccgc gcgcgcgtcg cctcgggtca ggcgaccttc       600
     gggctcgccg gctccctcga gggcgccgcc gcggcggcga gcgcgacgcc gctcgaggtc       660
     gtctacccgg accagctagg ctcgggcgcg gtggcgctgc ccaccgcggt ggcgctcctc       720
     ggcggcgcgt ccgacgccgc ccgcgccctc gcggcctggc tggcggggcc ggacgcggag       780
     cgggtgctgg tggcgcggat ccccgggctg ctcccgctgc gcgcggaggt gccggtgccg       840
     gtcggggtgg agccggcggg gaacatcgtc tcgctgccgt tcgattggga cgcgctcgcg       900
     gcggagacgg ggaagcagcg agcgcggctg gagcggtggc cggaggggtt caccgagcgg       960
     aagtga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page