(data stored in ACNUC7421 zone)

EMBL: CP000769.PE310

CP000769.PE310       Location/Qualifiers
FT   CDS_pept        363182..363523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0314"
FT                   /product="regulatory protein LuxR"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: ade:Adeh_0288
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24530"
FT                   /db_xref="GOA:A7H734"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A7H734"
FT                   /protein_id="ABS24530.1"
FT                   /translation="MAQIDIEILTPFAAKFMEGTTLTPAERAEVLRIAQGFACKDSAAA
FT                   AGVSPETIRARRKRIYRKLDVPGSGELLASLLALSLKMLAKGERIEPRPVTPAQPQPTT
FT                   TVSSAVVAR"
     atggctcaga tcgatatcga gatcctcacg ccgttcgccg ccaagttcat ggagggcacg        60
     acgctcacgc ctgctgagcg cgccgaggtc ctccggatcg cccagggctt cgcctgcaag       120
     gactccgcgg ccgccgctgg cgtctcgccc gagaccatcc gcgcgcgccg caagcgcatc       180
     taccgcaagc tcgacgtgcc cggctccggc gagctcctcg cgagcctcct cgcgctctcg       240
     ctcaagatgc tcgcgaaggg cgagcggatc gagccgcgcc ccgtcacgcc ggcgcagccg       300
     cagccgacca cgacggtgtc gtccgccgtc gtcgcccgct ag                          342
//

If you have problems or comments...

PBIL Back to PBIL home page