(data stored in ACNUC7421 zone)

EMBL: CP000769.PE313

CP000769.PE313       Location/Qualifiers
FT   CDS_pept        complement(366355..369396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0317"
FT                   /product="malto-oligosyltrehalose synthase"
FT                   /note="TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: ade:Adeh_0293
FT                   malto-oligosyltrehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24533"
FT                   /db_xref="GOA:A7H737"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A7H737"
FT                   /protein_id="ABS24533.1"
FT                   /translation="MASAAETAATERVALAAELVEALAQEAARGEGSTRRPASTYRLQL
FT                   HGGFGFEDAARVVPYLHALGVSDLYVSPILEAAPGSTHGYDVVNHGRLNPELGGEEGFL
FT                   RLAGACAQRGMGILVDFVPNHMGIGPRNAWWMDVLENGPSSVHARAFDVEWRPLKAELG
FT                   HKVLVPLLGDQFGKVLERGELQLAREGGALVVRYWDHVFPVAPRSVPQLLRHRLDELRG
FT                   ELGPGDVHYQELESICVSLEKLAPRTDTSPQAVADRAREKEVAKRRLASLCEASPRVRA
FT                   FVDENIRIFNGRKSERRSFDLLEKLLEGQAYRLAFWRVAGEEINYRRFFDVNALAAIRM
FT                   EEPRVFQEAHRLVLGLLRDGRISGLRIDHPDGLYAPPAYFRRLQASYLVERARALAARR
FT                   GTPLEPDTEALVLERVFEALEAGRLPPRPLYVVVEKILIAPERMPDGWDVDGTTGYEFL
FT                   AAVNGLFVEPEAERAFDGMWARLSGRREQFADVVADKKRLVMSSSMAGEVNMLAHRLNR
FT                   ISEMNRRTRDFTLNELTRALVEFVALFPVYRTYVTRRGEVDDRDRALVERTIARARRRS
FT                   PVVDPSIYDFLRDVVLQRYPEELTEDERREWLELTLKLQQITGPVTAKAVEDTAFYTYV
FT                   RLVSLNEVGGEPRHFGTTPEEVHGLLSERQARFPGSLSSTSTHDTKRSEDVRVRIDALS
FT                   EIPTEWRAAVLRWHRMNRAHVGGEGGGAPDRADELLLYQTLVGALPDGGVTPGTRAHAD
FT                   FVGRIQGYMEKALREAKVHTSWTSPNEDYEAGVRTFVERILASPAFLADLGAFSARVAA
FT                   VGRLSSLAQVAVKCAAPGVPDVYQGCELWDLSLVDPDNRRPVDYALRAQTLEALRADLA
FT                   RGPAARRDLARSVSAPETLADGRAKLLLLHAALHARREQRELFLAGDYRPAHAEGPHAR
FT                   SVFAFARAHAGNGGRAALCVVPRLVLGLLEAGGGRIRWEGALEVPHGLPRRWRDVVTGA
FT                   RREGDALPLAELFEDFPVAVLVSE"
     gtggcgagcg cggctgagac ggcggcgacc gagcgggtgg cgctcgcggc cgagctcgtc        60
     gaggcgctcg cgcaggaggc ggcgcgcggc gagggctcga cccggcggcc ggcctccacc       120
     taccgcctgc agctccacgg cgggttcggc ttcgaggacg ccgcccgagt cgtgccgtac       180
     ctccacgccc tcggcgtctc ggacctgtac gtctcgccca tcctcgaggc ggcgcccggc       240
     tccacgcacg ggtacgacgt cgtgaaccac ggccgcctca acccggagct cggcggcgag       300
     gagggcttcc tgcgcctcgc gggtgcgtgc gcccagcgcg gcatggggat cctcgtcgac       360
     ttcgtgccca accacatggg catcggaccg cggaacgcgt ggtggatgga cgtgctcgag       420
     aacgggccgt cgtcggtcca cgcgcgggcc ttcgacgtcg agtggcggcc gctgaaggcc       480
     gagctcggcc acaaggtgct cgtcccgctc ctcggggatc agttcgggaa ggtcctcgag       540
     cgcggcgagc tccagctcgc gcgcgagggc ggcgcgctcg tggtgcgcta ctgggaccac       600
     gtgttcccgg tcgcgccccg ctccgtgccg cagctgctgc ggcatcggct cgacgagctc       660
     cgcggcgagc tcggcccggg cgacgtccac taccaggagc tcgagtccat ctgcgtctcg       720
     ctggagaagc tcgcgccccg caccgacacc tcgccgcagg cggtcgcgga tcgcgcccgg       780
     gagaaggagg tcgcgaagcg ccgcctcgcg tcgctgtgcg aggcgagccc gcgcgtgcgg       840
     gcgttcgtgg acgagaacat ccgcatcttc aacggccgga agagcgagcg gcggagcttc       900
     gatctgctcg agaagctcct cgagggccag gcctaccggc tcgcgttctg gcgggtggcc       960
     ggcgaggaga tcaactaccg ccggttcttc gacgtgaacg ccctcgccgc gatccgcatg      1020
     gaggagccgc gcgtcttcca ggaggcccac cgcctcgtcc tcgggctcct gcgcgacgga      1080
     cgcatcagcg ggctgcgcat cgaccacccc gacggcctct acgccccgcc ggcgtacttc      1140
     cggaggctcc aggcgtcgta cctcgtcgag cgcgcccgcg ccctcgccgc ccggcgcggc      1200
     acgccgctcg agcccgacac ggaggcgctc gtcctcgagc gggtgttcga ggcgctcgag      1260
     gcggggcggc tcccgccccg gccgctctac gtggtcgtgg agaagatcct gatcgcgccg      1320
     gagcggatgc ccgacggctg ggacgtggac ggcaccaccg gctacgagtt cctcgccgcg      1380
     gtgaacgggc tgttcgtcga gccggaggcg gagcgcgcct tcgacggcat gtgggcgcgc      1440
     ctctccggcc gccgcgagca gttcgccgac gtggtggccg acaagaagcg gctcgtcatg      1500
     tcctcctcga tggcgggcga ggtgaacatg ctcgcgcacc ggctcaaccg catcagcgag      1560
     atgaaccggc gcacgcgcga cttcacgctg aacgagctca cccgcgcgct cgtggagttc      1620
     gtggccctgt tcccggtcta ccgcacctac gtcacgcggc gcggcgaggt ggacgaccgc      1680
     gaccgcgcgc tcgtcgagcg caccatcgcg cgcgcccggc ggcggagccc ggtcgtggac      1740
     ccgtccatct acgacttcct ccgcgacgtc gtgctccagc gctacccgga ggagctcacc      1800
     gaggacgagc ggcgggagtg gctcgagctc accctcaagc tccagcagat caccggcccg      1860
     gtgacggcca aggccgtcga ggacaccgcg ttctacacgt acgtgcggct ggtctccctg      1920
     aacgaggtcg gcggcgagcc gcgccacttc gggacgacgc cggaggaggt gcacggcctg      1980
     ctctcggagc ggcaggcgcg cttcccgggg tcgctctcct ccacctccac gcacgacacc      2040
     aagcggagcg aggacgtgcg cgtccggatc gacgcgctct cggagatccc caccgagtgg      2100
     cgcgccgcgg tgctgcgctg gcaccggatg aaccgggcgc acgtgggcgg cgagggcggc      2160
     ggcgcaccgg accgcgccga cgagctcctg ctctaccaga cgctcgtcgg cgccctgccc      2220
     gacggcgggg tgacgccggg cacgcgcgca cacgccgact tcgtgggcag gatccagggc      2280
     tacatggaga aggcgctccg cgaggcgaag gtgcacacga gctggacgag cccgaacgag      2340
     gactacgagg ccggcgtccg gaccttcgtc gagcgcatcc tcgcttcgcc cgccttcctc      2400
     gctgacctcg gcgcgttctc ggcgcgcgtc gccgccgtcg ggcggctctc ctcgctcgcc      2460
     caggtggccg tgaagtgcgc cgcgccgggc gtgccggacg tgtaccaggg ctgcgagctc      2520
     tgggatctct ccctcgtgga tcccgacaac cgccggccgg tggactacgc gctgcgcgcg      2580
     cagacgctcg aggcgcttcg cgcagacctc gcccgcggcc ccgcggcgcg ccgagacctc      2640
     gcccggagcg tctccgcccc ggagacgctc gccgacggcc gggcgaagct cctcctcctg      2700
     cacgcggcgc tgcacgcgcg acgggagcag cgcgagctct tcctcgccgg cgactaccgc      2760
     ccggcgcacg cggagggacc gcacgcccgg agcgtgttcg cgttcgcgag ggcgcacgcc      2820
     ggcaacggcg ggcgcgccgc gctgtgcgtg gtcccccggc tcgtgctcgg gctcctcgag      2880
     gcgggcggcg gccggatccg ctgggagggc gcgctcgagg tcccgcacgg cctgccgcgc      2940
     cggtggcgcg acgtcgtgac cggcgcgcgg cgcgagggcg acgcgctccc gctcgccgag      3000
     ctgttcgagg acttccccgt cgccgtgctg gtctcggagt ga                         3042
//

If you have problems or comments...

PBIL Back to PBIL home page