(data stored in ACNUC7421 zone)

EMBL: CP000769.PE316

CP000769.PE316       Location/Qualifiers
FT   CDS_pept        complement(372129..372668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2953 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24536"
FT                   /db_xref="UniProtKB/TrEMBL:A7H740"
FT                   /protein_id="ABS24536.1"
FT                   /translation="MHVRTVVVVVAMATLARAGTARAAVSLGLEATLGAEQLGVQRAPG
FT                   SNEPLAQMGQLGGTVLLRVGSLAVGAAAGGYFDGSRLERYDASGLAGLAFDVLPLLRLE
FT                   LLGELGAASLRSREDLGAAVAGEWSTFYGARPGVSLKIPAFPLRLGVWGLARWGLPGTP
FT                   SGEPALGMLGRVGVEF"
     atgcacgtcc ggacggtggt ggtggtggtg gcgatggcga cgctcgctcg ggcggggacg        60
     gcccgggcgg cggtgtctct ggggctcgag gccaccctcg gcgccgagca gctcggcgtg       120
     cagcgcgcgc cggggtcgaa cgagccgctg gcgcagatgg gccagctggg cgggaccgtc       180
     ctcctgcgcg tgggctcgct cgcggtggga gcggcggcgg gcgggtactt cgacggctcc       240
     cggctcgagc gctacgacgc gagcgggctc gccggtctcg ccttcgacgt gctgccgctc       300
     ctgcggctcg agctcctcgg cgagctgggc gccgcgagcc tgcgctcgcg cgaggacctc       360
     ggcgcggcgg tcgccggcga gtggtcgacc ttctacggcg cgcggccggg cgtgtcgctg       420
     aagatcccgg ccttcccgct gcgcctcggc gtgtgggggc tcgcgcgctg ggggctgccg       480
     gggaccccga gcggcgagcc cgcgctcggg atgctcggcc gggtgggcgt ggagttctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page