(data stored in ACNUC7421 zone)

EMBL: CP000769.PE32

CP000769.PE32        Location/Qualifiers
FT   CDS_pept        41514..42542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0032"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: ade:Adeh_0031 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24252"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A6"
FT                   /protein_id="ABS24252.1"
FT                   /translation="MRRLETWTALAIVGGAAALTLSRRIGRVRLPGKIALVTGGSRGLG
FT                   LLVARELGRRGMRVVVLARDEEELERARSSLAAEGIDVTALPCDVTDEEGIQGLVADVE
FT                   QNLGPIDVLVNNAGIIQVGPVETMKPDDYRRAMDVMFWGALNAAEAVLPGMRQRRRGTI
FT                   VNVTSIGAAVGLPHLAPYDAAKFALRGWSEALGAESIRHGVRVVTVVPGLMRTGSFGHA
FT                   LVKGKRYAEASLFTLFASLPLVTASAERAARRIVRAVENDERFVVIGLPAKGLRLAHAL
FT                   FPGTVVRTLGMVNRLLPPAEPGAREAIPLPGELFRRGLARSILTALGDRAARRYNEEPE
FT                   PA"
     gtgcggcgac tggagacctg gaccgcgctg gcgatcgtcg gaggggccgc ggcgctcacc        60
     ctctcgcggc ggatcgggcg cgtgcggctg cccggcaaga tcgcgctcgt gacgggcggc       120
     tcgcgcgggc tcgggctcct cgtcgcccgg gagctcggcc gccgaggcat gcgcgtcgtg       180
     gtgctcgccc gcgacgagga ggagctcgag cgcgcccgga gcagcctggc ggccgagggg       240
     atcgacgtca ccgccctgcc ctgcgacgtc accgacgagg aagggatcca ggggctcgtg       300
     gccgacgtgg agcagaacct cggccccatc gacgtgctgg tgaacaacgc gggcatcatc       360
     caggtcggcc cggtcgagac gatgaagccg gacgactacc ggcgggcgat ggacgtgatg       420
     ttctgggggg cgctcaacgc cgccgaggcg gtgctgcccg ggatgcggca gcggcggcgc       480
     ggcaccatcg tgaacgtcac ctcgatcggc gccgcggtcg ggctccccca cctcgcgccg       540
     tacgacgcgg ccaagttcgc cctgcgcggc tggtccgagg cgctcggggc ggagtcgatc       600
     cgccacgggg tgcgggtggt gaccgtggtc cccgggctca tgcgcaccgg ctccttcggc       660
     cacgccctcg tgaagggcaa gcgctacgcc gaggccagcc tgttcaccct cttcgcctcg       720
     ctgccgctcg tcaccgccag cgccgagcgc gcggcgcgcc ggatcgtccg cgccgtcgag       780
     aacgacgagc gcttcgtggt gatcggcctg ccggcgaagg ggctgcggct cgcgcacgcg       840
     ctcttcccgg gcacggtggt gcggaccctg gggatggtga accggctctt gccgccggcg       900
     gagcccggcg cccgcgaggc gatccccctg cccggcgagc tgttccgccg cggcctcgcg       960
     cgctcgatcc tcaccgcgct cggggatcgc gccgcgcggc gctacaacga ggagcccgag      1020
     ccggcgtag                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page