(data stored in ACNUC7421 zone)

EMBL: CP000769.PE321

CP000769.PE321       Location/Qualifiers
FT   CDS_pept        377638..378036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0326"
FT                   /product="protein of unknown function DUF606"
FT                   /note="PFAM: protein of unknown function DUF606; KEGG:
FT                   reu:Reut_A0176 protein of unknown function DUF606"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24541"
FT                   /db_xref="GOA:A7H745"
FT                   /db_xref="InterPro:IPR006750"
FT                   /db_xref="UniProtKB/TrEMBL:A7H745"
FT                   /protein_id="ABS24541.1"
FT                   /translation="MVPVQAGVNATLARHAGRPEWAAFVSFAVGLAGLAAYVVVLRVRP
FT                   PPLAALAAAPPWSWTGGLLGAFYVTAIVILTPRIGFTLALALTLAGQMIAALALDHAGA
FT                   LGLATRPVTAPRLVGAALLFAGVLLMRR"
     gtggtccccg tgcaggccgg cgtgaacgcc accctggctc gccacgcggg ccgcccggag        60
     tgggcggcgt tcgtgagctt cgcggtcggc ctcgccgggc tcgcggccta cgtcgtcgtg       120
     ctgagggtcc gcccgccgcc gctcgccgcg ctcgcggccg ccccgccctg gagctggacc       180
     ggcgggctcc tcggtgcgtt ctacgtgacc gcgatcgtga tcctcacgcc gcggatcggc       240
     ttcaccctcg cgctggcgct cacgctcgcc gggcagatga tcgcggcgct cgcgctcgac       300
     cacgcgggcg ccctggggct cgcgacgcgc cccgtcaccg ccccgcgcct cgtcggcgcg       360
     gcgctgctct tcgccggcgt cctgctgatg cgccgctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page