(data stored in ACNUC7421 zone)

EMBL: CP000769.PE323

CP000769.PE323       Location/Qualifiers
FT   CDS_pept        complement(379274..380866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0328"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: ade:Adeh_4097 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24543"
FT                   /db_xref="GOA:A7H747"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:A7H747"
FT                   /protein_id="ABS24543.1"
FT                   /translation="MARKQATAKARTGKATARKQPSVKAAGTPAIELAADALALPVYEE
FT                   DVRAGGRGRVKALDALLGGALAAAVKAERFAGKAGQELSLPTLGRAPAGRVLLLGMGPR
FT                   GKAEAWPSTGFEPLRHAAGKAARAAAKAGARALAVALPEDGVEDVAGAARALAEGALLG
FT                   AYAFERYKSEDDARRTPLAELTVAVPAGAERRAELRDALELAREIGAAVAWARDLVNLG
FT                   PADCTPTLLAEQAEALAREARLAVEVRGPKEIAALGMGMFLGVTRGSSEPARLVTLSWI
FT                   PRGAAAKKPPVVLVGKAITFDSGGLSLKPTESMVTMNTDMAGSAAVLGAMRVVARLAPP
FT                   FPVHAVLGACENMPGGKAYKPSDVLVSYAGKTVEITNTDAEGRLVLGDVLAWAAQTWNP
FT                   ALMVDVATLTGACMVALGHTTAGLFGPDGAAVDGLLAAAGASGEELWRLPMTESLKEQL
FT                   KSDRADLKNTGERWGGAIAAAHFLHAFVKDVPWAHLDIAGPSHAPKERGYVAKGGTGFG
FT                   VRTLVELVRAHRP"
     atggcgcgta agcaggcgac ggcgaaggcc cgcacgggca aggccacggc gaggaagcag        60
     ccctcggtga aggcggcggg gacccccgcg atcgagctcg ctgcggacgc gctcgcgctg       120
     ccggtctacg aggaggacgt ccgggccggc gggcgcggtc gggtgaaggc cctcgacgcg       180
     ctgctcggcg gcgccctggc ggcggccgtg aaggcggagc gcttcgcggg gaaggccggc       240
     caggagctct cgctcccgac gctggggcgc gcgcccgcgg gccgggtgct cctgctcggc       300
     atgggccctc gcggcaaggc ggaggcgtgg ccgtcgacgg gcttcgagcc gctccgccac       360
     gcggccggca aggccgcgcg cgccgcggcc aaggcgggcg cgcgcgcgct cgccgtcgcc       420
     ctccccgagg acggcgtcga ggacgtcgcc ggggcggcgc gggcgctcgc cgagggcgcg       480
     ctcctcggcg cctacgcctt cgagcgctac aagagcgagg acgacgcgcg gcggaccccg       540
     ctcgccgagc tcaccgtggc ggtgcccgcc ggcgcggagc ggcgggccga gctgagggac       600
     gcgctcgagc tcgcgcgcga gatcggcgcc gccgtggcct gggcgcggga cctcgtcaac       660
     ctggggcctg ccgactgcac ccccaccctc ctcgcggagc aggccgaggc cctcgcgcgc       720
     gaggcgcggc tcgccgtcga ggtgcggggc ccgaaggaga tcgcggcgct cggcatgggc       780
     atgttcctcg gcgtgacccg cggctcctcc gagccggccc ggctcgtcac cctgagctgg       840
     atcccgaggg gcgccgcggc gaagaagccg ccggtcgtgc tcgtcggcaa ggccatcacc       900
     ttcgactcgg gtggcctgtc gctgaagccc accgagagca tggtgaccat gaacaccgac       960
     atggccggct cggcggccgt cctcggcgcg atgcgcgtcg tcgcccgcct cgcgccgccg      1020
     ttcccggtgc acgcggtcct gggcgcctgc gagaacatgc ccggcggcaa ggcctacaag      1080
     ccctccgacg tgctcgtctc ctacgcgggc aagaccgtcg agatcaccaa caccgacgcg      1140
     gagggccggc tcgtgctcgg ggacgtgctg gcctgggccg cgcagacgtg gaacccggcg      1200
     ctgatggtcg acgtggcgac gctcaccggc gcctgcatgg tggccctcgg ccacaccacc      1260
     gccggcctct tcggcccgga cggcgcggcg gtggacggcc tgctcgccgc ggcgggcgcc      1320
     tccggcgagg agctctggcg gctgcccatg accgagtcgc tgaaggagca gctgaagagc      1380
     gatcgcgccg atctgaagaa caccggggag cgctggggcg gggccatcgc cgccgcgcac      1440
     ttcctccacg cgttcgtgaa ggacgtcccc tgggcgcacc tcgacatcgc gggcccctcc      1500
     cacgccccga aggagcgcgg ctacgtcgcg aagggcggga cgggcttcgg cgtgcgcacg      1560
     ctcgtcgagc tcgtgcgcgc ccaccggccg tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page