(data stored in ACNUC7421 zone)

EMBL: CP000769.PE324

CP000769.PE324       Location/Qualifiers
FT   CDS_pept        complement(380986..382833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0329"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; PBS lyase HEAT
FT                   domain protein repeat-containing protein; KEGG:
FT                   ade:Adeh_4096 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24544"
FT                   /db_xref="GOA:A7H748"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A7H748"
FT                   /protein_id="ABS24544.1"
FT                   /translation="MSAAEHPPAGGRFEPESLLGLVLDGRYELAAHLATGGMGAVFRAR
FT                   HVHLRKDVAVKVLRPDLSSSPDLVERFRREAEIASALEHDNIVRVTDFGRSPDGWLFLV
FT                   MELLCGESLFDRIRRDGCLSPEEAVPILWQVCAGLEAAHALGVVHRDLKPENVFLARTA
FT                   SGREVTKLLDFGIAKIADPASGASTQAGVVVGTPEYLAPEQALGGEVDARADLYAVGLI
FT                   AWRVLGGRHPFKADEPRALLMMQATRPVPPLTDPRPDLGAYPALVAAVARACAKEPDER
FT                   HPSASALRDDLGGSLGPAFVLPPNATPSPAISLSATPPARAPDPVGVADTRAALPPVRT
FT                   APIASSTLSLEAARLAGRARTLARSAARRARAAVRELGAHPRVVAAAAVAALLALTLAL
FT                   ALGWSRGRTAAEARSLLAGGRPGAALALLDRALAERPDDGELLLLRARALHLTGADAAA
FT                   LSAFAAARARGSLDDPARADLVAALAADRATADRAHRLLLEEGEAAVPAVLRAAREGAP
FT                   SQRLRALHLARDLGAEERLDRAAAYGALLDVPDCEVRREAAERLGEIGDRAALPALRRA
FT                   ALATVETKGFFGMTRRAQACGSAEAAAAARRIEAAARSP"
     gtgtccgccg ccgaacaccc gccagccggg ggccgattcg agcccgagtc gctcctcggc        60
     ctcgtcctcg acggaaggta cgagctcgcc gcgcacctcg cgaccggcgg gatgggggcg       120
     gtgttccggg cccgccacgt ccacctgcgc aaggacgtcg cggtgaaggt cctgcgcccg       180
     gacctctcct cctcgcccga cctcgtcgag cggttccggc gggaggcgga gatcgcgagc       240
     gcgctcgagc acgacaacat cgtgcgcgtg accgacttcg gtcgcagccc ggacggctgg       300
     ctcttcctcg tgatggagct gctgtgcggc gagagcctct tcgaccggat ccggcgcgac       360
     gggtgtctct cgccggagga ggcggtgccg atcctctggc aggtgtgcgc ggggctcgag       420
     gcggcgcacg ccctcggcgt cgtgcaccgc gacctcaagc ccgagaacgt cttcctcgcc       480
     cgcacggcca gcggacgcga ggtgacgaag ctcctcgact tcggcatcgc gaagatcgcc       540
     gaccccgcga gcggcgcctc cacgcaggcc ggggtcgtgg tcggcacgcc cgagtacctc       600
     gcgccggagc aggcgctcgg gggcgaggtc gacgcgcgcg ccgacctgta cgccgtcggc       660
     ctcatcgcct ggcgcgtgct gggcggccgc cacccgttca aggccgacga gccgcgcgcg       720
     ctgctcatga tgcaggcgac gcgcccggtg cccccgctca ccgacccgcg cccggacctc       780
     ggcgcctacc ccgcgctggt ggccgcggtg gcgcgcgcct gcgccaagga gccggacgag       840
     cgacatccgt ccgcgagcgc cctgcgcgac gatctcggcg gctccctcgg gcccgccttc       900
     gtgctgccgc cgaacgcgac cccgtcgccc gccatctccc tgtccgcgac gccgcccgcc       960
     cgggcgcccg acccggtggg cgtcgccgac acccgcgccg cgctcccgcc cgtccggacc      1020
     gccccgatcg cgtcgtcgac gctctcgctc gaggccgcgc gcctcgccgg gcgcgcccgc      1080
     acgctcgcgc ggtccgccgc ccggcgcgcg cgcgcggccg tccgcgagct gggcgcgcac      1140
     ccccgcgtcg tcgccgccgc cgcggtcgcc gccctgctcg cgctcacgct cgccctcgcg      1200
     ctcggctgga gccgcggcag gaccgccgcc gaggcgcgca gcctcctcgc cggcggccgg      1260
     cccggcgcgg ccctcgcgct cctcgatcgc gcgctggcgg agcgtccgga cgacggcgag      1320
     ctgctgctcc tccgcgcccg ggcgctgcac ctcaccggcg ccgacgcagc ggcgctctcc      1380
     gccttcgccg ctgcgcgcgc ccgcggctcc ctcgacgacc ccgcccgcgc ggacctcgtc      1440
     gcggcgctgg ccgcggaccg ggcgaccgcg gaccgggcgc accgcctcct gctcgaggag      1500
     ggcgaggccg ccgtccccgc ggtcttgcgc gccgcgcgcg agggggcccc ctcgcagcgg      1560
     ctccgggcgc tccacctcgc gcgcgacctg ggcgcggagg agcggctcga tcgcgccgcc      1620
     gcctacggcg ccctgctcga cgtgcccgac tgcgaggtgc ggcgcgaggc cgccgagcgg      1680
     ctcggcgaga tcggcgatcg cgccgcgctc cccgcgctgc ggcgggccgc gctcgcgacg      1740
     gtcgagacga aggggttctt cgggatgacc cggcgcgcgc aggcctgcgg gtccgccgag      1800
     gcggcggcgg ccgcccggcg catcgaggcg gcggcgcggt cgccgtga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page