(data stored in ACNUC7421 zone)

EMBL: CP000769.PE329

CP000769.PE329       Location/Qualifiers
FT   CDS_pept        complement(388748..390226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0334"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   ade:Adeh_4090 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24549"
FT                   /db_xref="GOA:A7H753"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A7H753"
FT                   /protein_id="ABS24549.1"
FT                   /translation="MSDSILTRARPLLVARLAGAVLTLAVPMVLARVLLPESYGTFKQA
FT                   WLLMNTLALVLPMGMTMSLYYFVPREPADRDAHVAQALWFHLVLGAFAAALVLAGAPLV
FT                   DRQFHNPELTRAVPWIAAFTALQIAGAPLDIAWNASGRIGAAAVARLVTEVVRGAAILA
FT                   GALLGGSVEAVFAGITVAHLLRAAWTFVTLARAHGLRFSASALRRQAAYALPFGAAFLL
FT                   IVPQQQFHQYAVAAAVSAAAFAVYSVGTFQLPVVDILYTPVSELLQIGLAEVEGAGRPA
FT                   RAGLPLFHEAVLQLAFAFLPLVGLLGVVAPALIELFFSARYLDAVPIFRIGILSVALAA
FT                   LPLDGVMRARAQNRYMLALSVAKLGATVPLVLGGLRVAGPIGALAGWTFAEAVARVVML
FT                   HRAARLFEVPLSRVLPMRSLARQLAATAFAMAPAWVTMRALHAAPPAVRLAAACGAFAL
FT                   AYLGLSWARGWLPAGWLSLFSTRRARTAVAPSES"
     ttgtccgatt cgatcctgac gcgggcccgc ccgctgctcg tcgcccgcct cgccggcgcc        60
     gtcctgaccc tggccgtgcc gatggtgctc gcgcgcgtgc tcctgccgga gtcctacggc       120
     acgttcaagc aggcctggct cctcatgaac acgctcgcgc tcgtgctgcc gatgggcatg       180
     acgatgagcc tctactactt cgtgccgcgc gagccggccg accgcgacgc gcacgtcgcg       240
     caggcgctgt ggttccacct cgtgctcggc gccttcgcgg ccgcgctcgt gctcgccggg       300
     gcgccgctcg tcgaccggca gttccacaac ccggagctga cgcgcgccgt gccgtggatc       360
     gcggccttca cggcgctcca gatcgcgggc gccccgctcg acatcgcgtg gaacgcctcc       420
     ggccggatcg gcgcggcggc ggtggcccgg ctcgtcaccg aggtggtgcg cggggcggcc       480
     atcctggcgg gcgcgctgct ggggggctcg gtcgaggcgg tcttcgcggg catcaccgtg       540
     gcgcacctgc tccgcgccgc gtggaccttc gtgacgctgg cgcgggcgca cggcctgcgg       600
     ttctcggcga gcgccctccg ccgtcaggcc gcctacgccc tgccgttcgg cgcggccttc       660
     ctgctcatcg tcccccagca gcagttccac cagtacgccg tggcggccgc ggtctcggcc       720
     gcggcgttcg ccgtctacag cgtcggcacc ttccagctgc cggtggtgga catcctctac       780
     acgcccgtct ccgagctgct ccagatcggc ctcgcggagg tggaaggcgc tggccggccc       840
     gcgcgagcgg ggctgccgct gttccacgag gccgtgctcc agctcgcgtt cgccttcctg       900
     ccgctcgtgg ggctcctcgg cgtcgtcgcg cccgcgctca tcgagctctt cttctcggcg       960
     cgctacctcg acgcggtccc gatcttcagg atcggcatcc tctccgtggc gctcgccgcg      1020
     ctcccgctcg acggcgtgat gcgcgcgcgc gcccagaacc gctacatgct cgcgctgtcc      1080
     gtggcgaagc tcggggccac cgtcccgctg gtgctcggcg ggctgcgggt ggccgggccg      1140
     atcggcgcgc tcgcgggctg gacctttgcg gaggccgtcg cgcgggtggt gatgctccac      1200
     cgggcggcgc ggctgttcga ggtgccgctc tcccgcgtgc tgcccatgcg gtcgctcgct      1260
     cgtcagctcg ccgcgaccgc cttcgcgatg gcgccggcct gggtgacgat gcgcgccctc      1320
     cacgcggcgc cgccggcggt gcgcctcgcc gccgcgtgcg gggccttcgc gctcgcgtac      1380
     ctcgggctgt cctgggcgcg cggctggctg ccggccggct ggctctcgct cttctcgacg      1440
     cggcgcgctc gcacggccgt ggctccgtcg gagtcatga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page