(data stored in ACNUC7421 zone)

EMBL: CP000769.PE33

CP000769.PE33        Location/Qualifiers
FT   CDS_pept        complement(42625..43872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0033"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: ade:Adeh_0032 membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24253"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A7"
FT                   /protein_id="ABS24253.1"
FT                   /translation="MRTTPILATLLLAPALASASGYEVISVNPRDLALSHSAVAVQVDA
FT                   AAASLNPAALSKLEGPTVSVGGSLLNIWTEWDGDPARGPAGHAQTRFEPVTPVAIYAGW
FT                   GTKLADRGFGVGVGFTQPFGGNVFWEDDWEGRGRIVEVQRRFFGTYATAGYEVLPQLRL
FT                   GGGLVWYYGFEYLKQGIQPIPAAYGELDTKGGGVTYQVSAEIQPVPSYPLVFGVDYKHK
FT                   AHVTLEGDGNFVVPPSLESADTRDQGVSHDVTLPNLLNVGVGWRPAKPVLLTLQYSWSR
FT                   WVEYVDDTFEGDAGLTLTVPRDYRNGQVVRGGVEWQALPALALRLGLMRDTSGLRDTTY
FT                   SPTLPDSNTTGVSTGLTWAFGKRGLAVNAAFFYGYRDEVETEGDIAFPGTFQTDIMITS
FT                   LSLSWNTDLARAARAR"
     atgcgcacga cgccgatcct cgccacgctc ctcctcgccc ccgccctcgc ctcggcgagc        60
     gggtacgagg tcatctccgt caacccgcgc gacctcgcgc tctcccactc cgcggtggcc       120
     gtgcaggtcg acgccgccgc ggcgtccctc aacccggccg cgctctcgaa gctcgagggc       180
     cccacggtct ccgtcggcgg ctccctcctg aacatctgga cggagtggga cggcgacccg       240
     gcccgcgggc cggccggcca cgcccagacc cgcttcgagc cggtgacccc cgtcgcgatc       300
     tacgcgggct ggggcacgaa gctcgccgac cgcggcttcg gcgtcggcgt cggcttcacg       360
     cagcccttcg gcggcaacgt gttctgggag gacgactggg aggggcgcgg ccgcatcgtc       420
     gaggtgcagc gccgcttctt cggcacctac gccaccgcgg gctacgaggt cctcccgcag       480
     ctccgcctcg gcggcgggct cgtctggtac tacgggttcg agtacctgaa gcagggcatc       540
     cagcccatcc cggcggcgta cggcgagctc gacacgaagg gcggcggcgt cacctaccag       600
     gtgtccgccg agatccagcc ggtgccctcc tacccgctcg tcttcggcgt cgactacaag       660
     cacaaggcgc acgtcacgct cgagggcgac ggcaacttcg tggtgccgcc gtccctggag       720
     agcgcggaca cgcgggacca gggcgtgtcc cacgacgtga cgctgccgaa cctgctcaac       780
     gtgggcgtag ggtggcgccc ggcgaagccc gtcctcctga cgctccagta ctcctggtcg       840
     cgctgggtgg agtacgtgga cgacaccttc gagggcgacg cgggcctcac gctcacggtg       900
     ccccgcgact accgcaacgg ccaggtcgtc cgcggcggcg tggagtggca ggcgctgccc       960
     gcgctcgcgc tgcgcctcgg gctcatgcgc gacacctccg ggctgcgcga cacgacctac      1020
     tcgccgacgc tcccggactc gaacaccacc ggcgtgtcga ccgggctcac ctgggcgttc      1080
     ggcaagcgcg ggctcgccgt gaacgccgcc ttcttctacg gctaccgcga cgaggtggag      1140
     acggaggggg acatcgcgtt ccccggcacg ttccagaccg acatcatgat cacctcgctg      1200
     agcctcagct ggaacacgga cctggcccgc gccgcccggg cgcgctag                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page