(data stored in ACNUC7421 zone)

EMBL: CP000769.PE331

CP000769.PE331       Location/Qualifiers
FT   CDS_pept        complement(391736..392722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0336"
FT                   /product="Quinone oxidoreductase putative PIG3"
FT                   /note="TIGRFAM: Quinone oxidoreductase putative PIG3; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: ade:Adeh_4084
FT                   zinc-binding alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24551"
FT                   /db_xref="GOA:A7H755"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A7H755"
FT                   /protein_id="ABS24551.1"
FT                   /translation="MKAVLFDGKGGPEIVRFAETSDPAPARGEVLVRVRAAALNRADLL
FT                   QRRGLYPPPPGTREDIPGLELAGEVAAVGAGVTAWKAGDRVMAIASGEAQAELAVAHER
FT                   MLVRIPDALSSEDAAAIPEACVTSHDALFTLGGLRPGWPVLVHAIGSGVSTAALQIAKA
FT                   AGATVIGTSRTADKLERARALGLDHGILVAKDEPRFAEEVRRLTGKRGCPLVLDFVGAP
FT                   YAAENLAALASGGRVVVIGTMGGPKAQLDLGLLMRARGAIVGTVLRPRPLEEKIAATQA
FT                   FARDVLPLVAAGAVKPVVDLVLPAERAREAHERMERNESFGKLVLTF"
     atgaaggcgg tcctgttcga cggcaagggc ggtcccgaga tcgtgcgctt cgccgagacc        60
     tccgatcccg cgccggcgcg cggcgaggtg ctcgtccgcg tgcgcgcggc ggcgctgaac       120
     cgcgcggatc tgctgcagcg ccgcggcctc tatccgccgc cgcccggcac gcgcgaggac       180
     atccccggcc tcgagctcgc gggcgaggtg gccgcggtcg gggcgggcgt caccgcctgg       240
     aaggcgggcg accgcgtgat ggccatcgcc tccggcgagg cacaggcgga gctcgcggtg       300
     gcccacgagc ggatgctcgt gcggatcccc gacgcgctct cctccgagga cgcggccgcc       360
     atcccggagg cgtgcgtcac ctcgcacgac gcgctcttca cgctgggcgg gctgcgtccc       420
     ggctggccgg tcctcgtcca cgccatcggc tcgggcgtct ccaccgccgc gctccagatc       480
     gcgaaggcgg cgggcgcgac ggtgatcggc acctctcgca ccgccgacaa gctcgagcgg       540
     gcgcgcgcgc tcgggctcga tcacgggatc ctggtcgcga aggacgagcc gaggttcgcg       600
     gaggaggtcc ggcgcctcac cggcaagcgg ggctgcccgc tcgtgctcga cttcgtgggc       660
     gcaccctacg cggcggagaa cctcgccgcg ctcgcctccg gcgggcgcgt cgtggtgatc       720
     gggaccatgg gcggcccgaa ggcgcagctc gatctggggc tcctcatgcg ggcccgcggc       780
     gccatcgtcg gcacggtgct gcgcccgcgg ccgctcgagg agaagatcgc cgcgacccag       840
     gcgttcgcgc gcgacgtcct cccgctcgtc gcggcgggcg cggtgaagcc ggtcgtggac       900
     ctggtgctgc ccgccgagcg cgcccgcgag gcgcacgagc gcatggagcg gaacgagagc       960
     ttcggcaagc tcgtcctgac cttctga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page