(data stored in ACNUC7421 zone)

EMBL: CP000769.PE334

CP000769.PE334       Location/Qualifiers
FT   CDS_pept        complement(394850..395647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0339"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_4082 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24554"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A7H758"
FT                   /protein_id="ABS24554.1"
FT                   /translation="MIRKIVQIDEARCDGCGQCIPSCAEGAIALVNGKARLSADVLCDG
FT                   LGACLGECPQGAITVIEREAADFDEAAVKAHLARARAPAQEPAPPALAAVAPPAPARPR
FT                   LSIVSDPAPSAGGGCPGSRPRTLTPRPAGPQRVAAGMASAQSRLGQWPVQLHLVPVTAS
FT                   YFQGADLLVAADCVPFAYAGFHDELLAGRAIVVGCPKLDDNDFYAEKLTAILTQSDVRS
FT                   VTVARMEVPCCGGIAMAARHAVAASGKKLPLTDVVVGVDGAVR"
     atgatccgga agatcgtgca gatcgacgag gcccgctgcg acggttgcgg gcagtgcatc        60
     ccttcctgcg ccgagggcgc catcgcgctc gtgaacggga aggcgcgcct ctcggcggac       120
     gtgctctgcg acggcctggg cgcctgcctg ggcgagtgcc cgcagggcgc gatcaccgtg       180
     atcgagcgcg aggcggcgga cttcgacgag gcggcggtga aggcgcacct cgctcgcgct       240
     cgcgctcccg cgcaggagcc cgccccgccc gcgctcgcgg ccgtcgcgcc gcccgcgccc       300
     gcgcgcccgc ggctctccat cgtctcggac cccgctccct cggcgggcgg aggttgcccc       360
     ggctcgcgcc cgcggacgct cacgccccgg cccgccggtc cccagcgcgt cgccgcaggg       420
     atggcctcgg cgcagagccg gctcgggcag tggccggtcc agctgcacct cgtcccggtg       480
     accgcctcct acttccaggg cgcggacctg ctcgtcgcgg cggactgcgt gcccttcgcc       540
     tacgccgggt tccacgacga gctcctcgcc ggacgggcca tcgtggtggg gtgcccgaag       600
     ctcgacgaca acgacttcta cgccgagaag ctcacggcga tcctcacgca gtccgacgtg       660
     cggagcgtca cggtcgcgcg catggaggtc ccctgctgcg gcgggatcgc catggccgcg       720
     cgccacgcgg tcgcggcgag cgggaagaag ctgccgctga cggacgtggt ggtgggggtg       780
     gacggcgcgg tgagatag                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page