(data stored in ACNUC7421 zone)

EMBL: CP000769.PE343

CP000769.PE343       Location/Qualifiers
FT   CDS_pept        402167..403699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0348"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   ade:Adeh_4075 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24563"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A7H767"
FT                   /protein_id="ABS24563.1"
FT                   /translation="MRSHRLATGVLAALALSVTACPEQRGGQAKPPRPPRGELAAGAAA
FT                   LPDALSVPRPPGPEWFGLYLVGKKAGFTKVQLSRELRDGRDVLVGRSETLVRATVGGKT
FT                   VERRAEEERVYEARHQGPLLAVRSVWAGDGGDRTVSGTCARAVCKLVEETAAGRQERTV
FT                   EGVTETAELADGVRLAAARRGAVRGRQLDLEKLRVKEMQDVFLRRETIAGGGVQEQVSV
FT                   VAESEAGDRLAAEYRVADDGRIVEIRLGEAIVARPEPEDVARSLEQVDLFALARVAVPR
FT                   PLPRTVPTTITFRLAGLPPSFQKGDARQRFARGRSGETVLSVTARRPLAADPARDTPLA
FT                   LARKGASADDLAATPQADADSAAIAALAKKIAGDAPGAYAAAQLLADDVYRRLEKAYGA
FT                   SHDRASEVLAAGRGDCTEHTVLLVALARALGIPARPVHGLVYARYEDGQDALYWHAWAE
FT                   VRSAGEWIAMDPTFGQPVADATHVALGVGTQVDTVGLLGALKVLGVEVKAGR"
     atgagatcgc atcgcctcgc caccggcgtc ctcgccgcgc tcgccctctc cgtcaccgcc        60
     tgccccgagc agcgcggggg ccaggcgaag ccgccgcgcc ccccgcgcgg cgagctcgcc       120
     gcgggcgccg cggccctgcc cgacgcgctc agcgtcccgc gcccgcccgg gccggagtgg       180
     ttcggcctgt acctcgtcgg caagaaggcg ggcttcacga aggtccagct ctcccgcgag       240
     ctgcgcgacg gccgcgacgt gctcgtcggc cgcagcgaga cgctcgtgcg cgcgaccgtc       300
     ggcggcaaga ccgtggagcg cagggcggag gaggagcgcg tctacgaggc ccgccaccag       360
     ggcccgctcc tggcggtgcg ctcggtgtgg gcgggcgacg ggggcgaccg caccgtgtcg       420
     ggcacctgcg cgcgcgcggt gtgcaagctc gtcgaggaga cggccgcggg gcggcaggag       480
     cgcaccgtcg agggcgtcac ggagacggcg gagctcgcgg acggcgtccg gctcgccgcg       540
     gcccgccgcg gcgcggtgcg cggccggcag ctcgatctcg agaagctgcg ggtgaaggag       600
     atgcaggacg tcttcctgag gcgcgagacg atcgcgggcg ggggcgtcca ggagcaggtg       660
     tcggtggtcg ccgagtccga ggcgggcgac cggctcgccg cggagtaccg cgtggcggac       720
     gacggccgga tcgtggagat ccggctcggc gaggccatcg tcgcccggcc cgagcccgag       780
     gacgtcgccc gcagcctcga gcaggtggat ctgttcgcgc tcgcgcgcgt cgcggtcccg       840
     cgcccgctcc cccgcaccgt gcccaccacc atcaccttcc ggctggcggg gcttccgccc       900
     tcgttccaga agggcgacgc gcgtcagcgc ttcgcccgcg gccgctccgg cgagaccgtg       960
     ctcagcgtga cggcgcgccg cccgctcgcg gccgaccccg ccagggacac gccgctcgcc      1020
     ctggccagga agggcgcgag cgccgacgac ctggccgcga cgcctcaggc ggacgccgac      1080
     tccgcggcga tcgccgcgct cgcgaagaag atcgcgggcg acgccccggg cgcgtacgcc      1140
     gcggcccagc tgctcgccga cgacgtgtac cgccggctgg agaaggcgta cggggcgagc      1200
     cacgaccgcg cgagcgaggt gctcgccgcc ggccgcgggg attgcacgga gcacaccgtg      1260
     ctgctcgtgg ccctggcgcg cgcgctcggc atccccgcgc gcccggtgca cgggctcgtg      1320
     tacgcgcgct acgaggacgg gcaggacgcg ctctactggc acgcctgggc ggaggtgcgg      1380
     agcgccggcg agtggatcgc gatggatccg accttcgggc agccggtggc ggatgcgacc      1440
     cacgtggccc tcggggtggg gacgcaggtg gacacggtcg ggctcctcgg cgcgctgaag      1500
     gtcctcgggg tggaggtgaa ggccgggagg tga                                   1533
//

If you have problems or comments...

PBIL Back to PBIL home page