(data stored in ACNUC7421 zone)

EMBL: CP000769.PE35

CP000769.PE35        Location/Qualifiers
FT   CDS_pept        complement(47076..48455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0035"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: azo:azo0467 probable
FT                   long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24255"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6A9"
FT                   /protein_id="ABS24255.1"
FT                   /translation="MNKILIRRASLAAAIACALIASPSGALASGFQLIEQNGSGLGNAY
FT                   AGQAAAAEDASAIFFNPAGLTRVQGLQVVAALNLIRPSPDFSDGGSTPATLQPTLGGTG
FT                   GDGGSLALVPNGYVSFETVPGVIWTGLGLSVPFGLETEWDSGWMGRFHAIKSAVQTINL
FT                   NPTVAWKVAPWLSLGAGANYQWLDAELTNSVNYSAAAFAVGGATALGALAASGCGGATG
FT                   GCEGVANVSGDTWSWGWNVGALVELPTKTRVGVSYRSRIKHYVKGDVSFANRPALLAAG
FT                   LPDGAIQTTIELPDTLSAAVAQPVGDALELLADYTWTGWSTLKDLSIFRESGAPLTSTP
FT                   LEFDDSWRVGLGASYRATEALKIRLGTAYDRTPVQDEFRTPRLPDEDRWWLAGGVQWAF
FT                   TRQAALDVGAAYLIIDEASSDLPNVDASPPAGFSAPPRGHLVGSYDASVWLASAQVRFS
FT                   F"
     gtgaacaaga tcctcattcg acgcgcttcg ctcgcggcgg cgatcgcgtg cgcgctcatc        60
     gcctcgccga gcggcgccct cgcctccggc ttccagctca tcgagcagaa cgggagcggg       120
     ctcgggaatg cctacgccgg ccaggcggcc gcggcggagg acgcgagcgc catcttcttc       180
     aaccccgccg gcctgacccg ggtccaaggg ctccaggtgg tggccgcgct caacctcatc       240
     cggccgtctc ccgacttcag cgacggcggc tcgacccccg ccacgctgca gcccaccctc       300
     ggcggcaccg gcggcgacgg cggctccctc gcgctggtcc cgaacggcta cgtctccttc       360
     gagacggttc ccggcgtgat ctggacgggg ctcggcctga gcgtcccgtt cggcctcgag       420
     acggagtggg actccggctg gatgggccgc ttccacgcca tcaagtccgc ggtgcagacc       480
     atcaacctca acccgacggt ggcgtggaag gtcgcgccct ggctgtcgct cggcgccggc       540
     gcgaactacc agtggctcga cgccgagctg acgaactcgg tgaactacag cgcggccgcg       600
     ttcgccgtgg gtggcgcgac ggcgctcggc gcgctcgcgg cgtcgggctg cggtggcgcc       660
     accggcggct gcgaaggcgt cgccaacgtc tccggcgaca cgtggagctg gggctggaac       720
     gtcggcgcgc tggtcgagct cccgacgaag acgcgcgtgg gggtgtcgta ccggtcccgc       780
     atcaagcact acgtgaaggg cgacgtctcc ttcgccaacc ggcccgcgct gctcgccgcc       840
     gggcttccgg acggcgccat ccagacgacc atcgagctgc cggacacgct ctcggcggcg       900
     gtcgcgcagc cggtcggcga cgcgctcgag ctgctcgccg actacacgtg gacgggctgg       960
     tccacgctca aggacctctc gatcttcagg gagagcggcg cgccgctcac gagcacgccg      1020
     ctcgagttcg acgacagctg gcgcgtgggt ctcggcgcga gctatcgggc gacggaggcg      1080
     ctgaagatcc ggctcggcac cgcctacgac aggacgccgg tgcaggacga gttccgcacg      1140
     ccgcgcctcc cggacgagga ccgctggtgg ctggcgggcg gcgtccagtg ggcgttcacg      1200
     aggcaggccg cgctcgacgt cggcgccgcg tacctcatca tcgacgaggc cagcagcgac      1260
     ctgcccaacg tggacgcgag ccccccggcg gggttctcgg ccccgccgcg cgggcacctc      1320
     gtgggctcgt acgacgcgag cgtgtggctc gcgagcgccc aggttcgctt ctcgttctga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page