(data stored in ACNUC7421 zone)

EMBL: CP000769.PE353

CP000769.PE353       Location/Qualifiers
FT   CDS_pept        413009..413872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0358"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; KEGG:
FT                   mxa:MXAN_5924 TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24573"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A7H777"
FT                   /protein_id="ABS24573.1"
FT                   /translation="MTPLRALLTLSLATALAGCEREPKTIVAAPADPPRSTRAPAEPAD
FT                   APPPAPGAPDGARGAPMTPAPGAPGQGLPSSAELLAQVEAMKGQLASAPKSLEILLALG
FT                   NLYFQERRYPDAIGWYDQAVALAEPVWKDYLALPAAAREKEPAAAVKQACTRTEQRGFE
FT                   ALAKEASARARKKDVAGAGYCYRAALEPSIGVRIQRANARLLGGDERGAIADHEALLAR
FT                   VPDQPDALYFLGLALAETARGDVAQLERARALWKRVAELQPNGPYADDLKLATAEVERR
FT                   IAAARR"
     atgaccccgc tccgcgccct cctcacgctg tccctcgcca ccgcgctcgc cgggtgcgag        60
     cgcgagccga agaccatcgt ggcggcgccg gcggatccgc cccgctcgac gcgcgcgccc       120
     gccgagcccg cggacgcgcc gcctcccgcc ccgggcgcgc ccgacggtgc gcgcggggcc       180
     cccatgacgc ccgctccagg cgcgccagga caggggctgc cctcctcggc ggagctcctc       240
     gcgcaggtcg aggcgatgaa ggggcagctc gcctcggcgc ccaagtcgct cgagatcctg       300
     ctcgccctcg ggaacctgta cttccaggag cgccgctacc ccgacgccat cggctggtac       360
     gaccaggcgg tcgcgctcgc cgagccggtc tggaaggact acctggcgct gccggcggcg       420
     gcccgggaga aggagcccgc ggccgcggtg aagcaggcct gcacgcgcac ggagcagcgg       480
     gggttcgagg cgctcgcgaa ggaggcgtcg gcgcgcgcgc ggaagaagga cgtcgccggc       540
     gccggctact gctaccgcgc cgcgctcgag ccctccatcg gcgtgcgcat ccagcgcgcc       600
     aacgcgaggc tcctcggcgg cgacgagcgg ggcgccatcg ccgaccacga ggcgctcctc       660
     gcgcgcgtcc cggaccagcc cgacgcgctg tacttcctcg gcctcgcgct cgccgagacg       720
     gcgcgcgggg acgtcgccca gctcgagcgg gcgcgggcgc tgtggaagcg cgtcgccgag       780
     ctccagccga acggcccgta cgcggacgac ctgaagctcg cgaccgccga ggtggagcgg       840
     cgcatcgcgg cggcgagacg ttag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page