(data stored in ACNUC7421 zone)

EMBL: CP000769.PE354

CP000769.PE354       Location/Qualifiers
FT   CDS_pept        414062..414667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0359"
FT                   /product="Glutathione S-transferase domain"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   ade:Adeh_3380 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24574"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A7H778"
FT                   /protein_id="ABS24574.1"
FT                   /translation="MPKLYYVPRTRAARPRIVLEELGIPYELVRLDPGSGETRTPEHLA
FT                   RHPLGHVPVLEDGEVRLFESGAICFWLAERYGEGRLLAPPGSPARALAYQWLCFALSEL
FT                   EPPLAPLAAELKKPEPERDRARVEEGRARFHAAARAVDAALPGREFLLGSELSVADVVV
FT                   AAVLSYGKFLAGLEGLPAAEAYVLRLRSRPAWKRAMAD"
     atgccgaagc tctactacgt gccccgcacc cgcgccgcgc gcccccgcat cgtcctcgag        60
     gagctcggga tcccctacga gctcgtccgc ctcgatcccg ggagcggtga gacccgcacg       120
     ccggagcacc tcgcgcgcca tcccctcggg cacgtgcccg tgctggagga cggcgaggtc       180
     cgcctgttcg agtccggtgc catctgcttc tggctcgcgg agcgctacgg ggagggcagg       240
     ctcctcgcgc cccccggatc ccccgcccgc gcgctcgcct accagtggct gtgcttcgcg       300
     ctctccgagc tggagccacc gctcgcgccc ctcgccgccg agctgaagaa gcccgagccg       360
     gagcgggacc gcgcgcgcgt cgaggagggc agggcgaggt tccacgccgc ggcgcgcgcg       420
     gtggacgccg cgctccccgg ccgggagttc ctcctcgggt cggagctctc ggtcgcggac       480
     gtcgtcgtcg ccgcggtgct ctcctacggg aagttcctcg ccggcctcga gggcctgccg       540
     gccgccgagg cgtacgtgct ccggctgcgc agtcgccccg cgtggaagcg cgcgatggcg       600
     gactga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page