(data stored in ACNUC7421 zone)

EMBL: CP000769.PE356

CP000769.PE356       Location/Qualifiers
FT   CDS_pept        415392..416054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24576"
FT                   /db_xref="GOA:A7H780"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:A7H780"
FT                   /protein_id="ABS24576.1"
FT                   /translation="MHVASARSSQPSPVEKTGSARAGRAALVAALLALALSAVGPKDRL
FT                   TWLMEVAPVLVAVPVLVATRRVFPLTPLLYVLLAVHAAILCLGGHYTYAEVPLGFWVRD
FT                   ALGLARNHYDRLGHLAQGFVPALVAREVLLRTSPLRQGRWLFVLVTAVALAISALYEFV
FT                   EWGAALALGQSADAFLGTQGDPWDTQWDMFLAFLGAMAAQLALGRAQDRQLERLGRR"
     atgcacgtgg ccagcgcccg tagctcgcag ccctctcccg tcgagaagac cggcagcgca        60
     cgcgccggac gcgccgcgct ggtcgccgcg ctgctcgcgc tcgccctctc cgcggtcggg       120
     ccgaaggatc ggctcacctg gctcatggag gtcgcgccgg tgctcgtggc ggtcccggtg       180
     ctggtcgcca cgaggcgcgt cttcccgctc acgccgctgc tgtacgtgct cctggcggtg       240
     cacgcggcga tcctctgcct cggcgggcac tacacctacg ccgaggtgcc gctcggcttc       300
     tgggtgaggg acgcgctggg gctcgcgcgc aaccactacg accggctcgg ccacctcgcc       360
     cagggcttcg tcccggcgct ggtggcgcgc gaggtcttgc tgcgcacctc cccgctgcgg       420
     cagggccgct ggctcttcgt cctcgtcacc gccgtggcgc tcgcgatctc cgcgctctac       480
     gagttcgtcg agtggggcgc cgccctcgcg ctcggccagt ccgccgacgc gttcctcggg       540
     acgcagggcg atccctggga cacgcagtgg gacatgttcc tcgcgttcct cggggcgatg       600
     gccgcgcagc tcgccctcgg ccgcgcgcag gaccggcagc tcgaacgcct cgggcgtcgc       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page