(data stored in ACNUC7421 zone)

EMBL: CP000769.PE360

CP000769.PE360       Location/Qualifiers
FT   CDS_pept        complement(418930..419376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24580"
FT                   /db_xref="UniProtKB/TrEMBL:A7H784"
FT                   /protein_id="ABS24580.1"
FT                   /translation="MRDRRWDHLYDRERQPVKAYVLERFAGELARELEAWPPPFVEWVS
FT                   DELRARWAAGAAERPRDDVLRFALEVARLDLVRDFEGVERHLAADAHRLQTPAEAAALH
FT                   LLVRLVTEKCLGLKEYAEGARLRREDLAAMLHDVERRLFRVTLA"
     gtgcgcgatc gccgctggga ccacctgtac gaccgcgagc ggcagccggt gaaggcctac        60
     gtgctggagc gcttcgccgg agagctcgcc cgggagctgg aggcgtggcc gccgcccttc       120
     gtcgagtggg tctcggacga gctgcgggcg cggtgggcgg ccggcgcggc ggagcggccg       180
     cgcgacgacg tcctgcgctt cgccctcgag gtcgcccggc tcgatctcgt gcgcgacttc       240
     gagggtgtcg agcgtcacct cgccgccgac gcgcaccgcc tgcagacgcc cgcggaggcg       300
     gcggcgctcc acctgctcgt gcggctcgtg accgagaagt gcctcgggct caaggagtac       360
     gccgaggggg cgcgcctgcg gcgggaggac ctcgccgcca tgctgcacga cgtggagcgg       420
     cggctgttcc gggtgacgct ggcctga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page