(data stored in ACNUC7421 zone)

EMBL: CP000769.PE361

CP000769.PE361       Location/Qualifiers
FT   CDS_pept        complement(419451..420350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0366"
FT                   /product="PGAP1 family protein"
FT                   /note="PFAM: PGAP1 family protein; KEGG: ade:Adeh_4060
FT                   alpha/beta hydrolase fold acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24581"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H785"
FT                   /protein_id="ABS24581.1"
FT                   /translation="MPGAPPCRRPKGALHCWREVLRMKVLRVIRRAARRVDEIAAALEL
FT                   PGTQDRIEKRTDFSRCPRPVLLLHGFFASRRTFDILEARLRRDGYGVFSLHLGGFGGTF
FT                   NTRGIDDVADLVRAKIERIYARNPGMGPLTIVGHSKGGLVAAYYVKRLGGWRRTRAVVT
FT                   LGTPHHGTPLAYLGLPLGGVSRSVWQMMPGSAFLERLRDGPWPAQVRLASIWSRRDGWA
FT                   PYPSAVLDTHGLPHLVNVEVRGEHRSFLTSKRVYQAILREIRTGEDQAPLVRGPLTAMR
FT                   GGRAAENGARAVSGSDAA"
     ttgcccggtg cgcccccctg ccgccgcccg aaaggcgcgt tacattgctg gcgggaggtg        60
     ctccgcatga aggtcctgcg ggtcatccgg cgagcggcgc ggcgggtgga cgagatcgcg       120
     gcggccctgg agctgccggg aacccaggac cggatcgaga agcggaccga cttctcgcgc       180
     tgcccgcgac cggtgctcct cctccacggg ttcttcgcct cgcggcgcac cttcgacatc       240
     ctggaggcgc ggctccggcg cgacggctac ggggtcttct cgctccacct cggcggcttc       300
     ggcggcacct tcaacacgcg cgggatcgac gacgtggccg atctcgtccg cgcgaagatc       360
     gagcgcatct acgcgcgcaa cccgggcatg ggcccgctca ccatcgtcgg ccactccaag       420
     ggcgggctcg tcgccgccta ctacgtgaag cggctgggcg gctggcggcg cacgcgcgcg       480
     gtcgtgacgc tcgggacccc gcaccacggc acgccgctcg cctacctcgg cctgccgctc       540
     ggcggggtct cacgctcggt gtggcagatg atgccgggga gcgccttcct cgagcgcctg       600
     cgagacggtc cctggcccgc gcaggtgcgg ctcgcgtcga tctggtcgcg ccgggacggc       660
     tgggcgccct acccgagcgc cgtgctcgac acgcacggcc tcccgcacct cgtgaacgtg       720
     gaggtccgcg gggagcaccg ctccttcctc acgagcaagc gcgtgtacca ggcgatcctc       780
     cgcgagatcc ggacgggcga ggaccaggcg ccgctcgtgc gcggcccgct caccgccatg       840
     cgcgggggcc gggcggcgga gaacggcgcg cgcgccgtgt ccggctccga cgcggcgtga       900
//

If you have problems or comments...

PBIL Back to PBIL home page