(data stored in ACNUC7421 zone)

EMBL: CP000769.PE365

CP000769.PE365       Location/Qualifiers
FT   CDS_pept        complement(422820..423662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0370"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="TIGRFAM: tryptophan synthase, alpha subunit; PFAM:
FT                   tryptophan synthase alpha chain; KEGG: ade:Adeh_4058
FT                   tryptophan synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24585"
FT                   /db_xref="GOA:A7H789"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:A7H789"
FT                   /protein_id="ABS24585.1"
FT                   /translation="MKTAKASAPAAAAPPTDRIAAAFARCRARGEAALVTYVMGGDPDL
FT                   ATSRAMALACVEGGADLLELGVPFSDPMADGPTIQHAAERALASGTTPDGVLEVAAAVR
FT                   ARSDVPIALMGYLNPILARGVDRFAQGCARAGVDAVIVPDLLPEEAGDVAPVLAARGIR
FT                   TVFLLAPTSDAARVEAAARAATGFLYFVSVTGVTGARRAVAAEIAPAVAAIRAKSPVPV
FT                   VIGFGVSSPAQARELGPLADGVVVGSAIVQRVAEGGSRAARGARVTRFVRSLKRALRR"
     atgaagacgg cgaaggccag cgcaccggcc gcggcggcgc ccccgaccga tcggatcgcg        60
     gcggcgttcg cgcgctgccg ggcccggggc gaggcggcgc tcgtgacgta cgtgatgggc       120
     ggcgatcccg acctcgccac ctcgcgggcg atggcgctcg cctgcgtcga gggcggcgcc       180
     gacctgctcg agctcggcgt ccccttctcc gatcccatgg cggacggccc caccatccag       240
     cacgccgcgg agcgcgcgct cgcgtcgggc acgacgccgg acggcgtgct cgaggtggcc       300
     gcggcggtgc gcgcgcgctc ggacgtgccc atcgcgctca tgggctacct gaacccgatc       360
     ctcgcccgcg gcgtcgaccg gttcgcccag ggctgcgctc gcgccggggt ggacgcggtg       420
     atcgtccccg atctcctccc cgaggaggcc ggcgacgtgg cccccgtcct cgccgcgcgc       480
     gggatccgca ccgtgttcct gctcgcgccc acctccgacg cggcccgcgt cgaggccgcg       540
     gcccgcgccg ccaccgggtt cctctacttc gtctccgtga ccggagtgac cggcgcccgg       600
     cgggcggtcg cggcggagat cgcgccggcg gtcgccgcca tccgcgcgaa gagcccggtg       660
     ccggtggtga tcggcttcgg cgtttcctcg cccgcgcagg cgcgcgagct gggaccgctc       720
     gcggacgggg tggtggtcgg gagcgccatc gtgcagcgcg tcgccgaggg cggctcccgc       780
     gcggcgcgcg gcgcgcgcgt cacccgcttc gtgcgctcgc tcaagcgggc gcttcggcgc       840
     tga                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page