(data stored in ACNUC7421 zone)

EMBL: CP000769.PE366

CP000769.PE366       Location/Qualifiers
FT   CDS_pept        complement(423659..424939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0371"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: ade:Adeh_4057 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24586"
FT                   /db_xref="GOA:A7H790"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A7H790"
FT                   /protein_id="ABS24586.1"
FT                   /translation="MTVPLPDPRGRFGAYGGRYVPETLVPALEELEAAWRAAREDPAFE
FT                   AELAELLTRFAGRETPLGEARRMSADAGGCRILLKREDLCHTGAHKVNNTLGQVLLARR
FT                   MGKTRIIAETGAGQHGVATATAAALFGLPCDVFMGALDVERQALNVFRMQLLGARVVPV
FT                   ESGSRTLKDAMNEALRDWVTNVRDTHYIIGSVAGPHPYPALVRDFQSVIGAEARRQCLE
FT                   VAGRLPDAVVACVGGGSNAMGIFSAFLEDPGVTLVAVEAAGHGLATGRHGASLAKGRPG
FT                   VLHGSRSYVLQDEHGQIREAHSISAGLDYPGVGPELAHLNDSGRLTLMQASDDDALEAL
FT                   QYLARMEGIIPALETAHAVAAARQVARALGPEGLLVVNVSGRGDKDVDQVRRALAARAA
FT                   PGRKAAPRRRARRPAPAAAPRRKRSGR"
     atgacggtcc ccctccccga cccacgcggc cggttcggcg cgtacggcgg gcgctacgtc        60
     cccgagacgc tcgtccctgc cctcgaggag ctcgaggccg cgtggcgcgc ggcgcgcgag       120
     gaccccgcct tcgaggccga gctggcggag ctcctcaccc gcttcgccgg gcgcgagacc       180
     ccgctcggag aggcgcgtcg catgagcgcg gacgcggggg gctgccggat cctgctgaag       240
     cgcgaggacc tctgccacac cggcgcgcac aaggtgaaca acaccctcgg ccaggtgctg       300
     ctcgcgcgga ggatggggaa gacccgcatc atcgccgaga ccggcgcggg gcagcacggc       360
     gtcgccaccg ccaccgccgc ggcgctgttc gggctgccct gcgacgtgtt catgggcgcg       420
     ctcgacgtcg agcgccaggc gctgaacgtc ttccgcatgc agctcctcgg cgcgcgcgtc       480
     gtcccggtgg agtccggctc gcgcacgctc aaggacgcga tgaacgaggc gctgcgcgac       540
     tgggtgacga acgtgcgcga cacccactac atcatcggct cggtcgccgg cccgcacccg       600
     taccccgccc tcgtgcgcga cttccagtcg gtgatcggcg cggaggcgcg gcggcagtgc       660
     ctggaggtcg cggggcggct ccccgacgcc gtggtggcct gcgtcggcgg cggctccaac       720
     gcgatgggga tcttctcggc gttcctggag gatcccgggg tgacgctcgt ggcggtcgag       780
     gccgccggcc acgggctcgc gaccggccgg cacggcgcct cgctcgcgaa gggccggccc       840
     ggcgtgctcc acggctcgcg cagctacgtc ctgcaggacg agcacggcca gatccgcgag       900
     gcgcactcca tctccgccgg cctcgactat ccgggggtcg gcccggagct ggcgcacctg       960
     aacgacagcg gccggctgac gctcatgcag gcgagcgacg acgacgcgct cgaggcgctg      1020
     cagtacctcg cgcgcatgga ggggatcatc cccgccctcg agaccgcgca cgcggtcgcc      1080
     gcggcccggc aggtcgcccg cgcgctcggg ccggaggggc tcctcgtggt gaacgtgtcg      1140
     gggcggggtg acaaggacgt ggaccaggtc cgccgcgcgc tcgcggcgcg agcggcgccc      1200
     ggccggaagg ccgcgccccg ccgccgcgcc aggcgcccgg cgccagcggc ggcgccgcgc      1260
     cgcaagagga gcggacgatg a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page