(data stored in ACNUC7421 zone)

EMBL: CP000769.PE376

CP000769.PE376       Location/Qualifiers
FT   CDS_pept        complement(434636..435673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0381"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24596"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7A0"
FT                   /protein_id="ABS24596.1"
FT                   /translation="MRRLAVAIALAFGAPVLAQDEALPPPPPPPAYEGDVPLPPPPSGT
FT                   RPLSQLDPRLPPAQRPAPPHAAPASGAFQGGAIGESPVAPAGSPAAPLHPDETIGHWRY
FT                   AMASGVAGRFGGMQLDPDRENPGVLLYFGAQADGLWSEGFGKSARLRLRMFTGGESEVY
FT                   LPSDGEIEGAFMIGRREFRFVLGRLEVGRYPALGVNVLAQLATLPCFEGSLPLLGDTMR
FT                   LYYYVSPVEASFVRYHGDAHIEHSAAWATESDVPVAASAGRLRWTLLLPPSVLLSLQGD
FT                   LMKMWNKADTFLAGEASLGYQVLDGSAVFNVAARWDRYRRRGLGAETSETDGEMKLLAI
FT                   ASLVF"
     atgagacgcc tcgccgtcgc gatcgccctc gcgttcggag cgccggtcct cgcccaggac        60
     gaggcgctcc ccccgccgcc gccgccgccc gcctacgagg gggacgtccc cctccccccg       120
     ccgccctccg gcacccggcc gctctcgcag ctcgatccga ggctgccccc ggcccagcgc       180
     ccggcgccgc ctcacgcggc gccggcctcg ggcgcgttcc agggcggcgc gatcggcgag       240
     tcacccgtcg cgcccgccgg ctcgccggcg gcgccgctgc accccgacga gacgatcggc       300
     cactggcgct acgcgatggc gagcggcgtg gccggccgct tcggcgggat gcagctcgac       360
     cccgaccgcg agaaccccgg cgtgctgctg tacttcggcg cgcaggcgga cggcctgtgg       420
     tccgagggct tcggcaagtc ggcgcggctc cggctgcgga tgttcaccgg cggcgagagc       480
     gaggtctacc tgccgtcgga cggcgagatc gagggcgcct tcatgatcgg ccggcgcgag       540
     ttccgcttcg tgctcgggcg cctcgaggtc gggcgctacc ccgcgctcgg cgtgaacgtg       600
     ctcgcgcagc tcgccacgct cccgtgcttc gagggctccc tgccgctcct cggcgacacg       660
     atgcgcctct actactacgt ctctccggtg gaggcctcgt tcgtccgcta ccacggcgac       720
     gcgcacatcg agcactcggc ggcgtgggcg accgagtcgg acgtgcccgt cgcggcgagc       780
     gcgggccggc tgcgctggac gctgctcctg ccgccgtccg tgctgctgtc gctccagggc       840
     gacctcatga agatgtggaa caaggccgac acgttcctgg ccggcgaggc gagcctcggc       900
     taccaggtgc tcgacgggtc cgcggtgttc aacgtcgccg cccgctggga ccgctaccgc       960
     cgccgcgggc tcggcgcgga gacgagcgag acggacggcg agatgaagct gctcgccatc      1020
     gcgtcgctgg tgttctga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page