(data stored in ACNUC7421 zone)

EMBL: CP000769.PE391

CP000769.PE391       Location/Qualifiers
FT   CDS_pept        complement(450073..450447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0396"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: ade:Adeh_4031 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24611"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B5"
FT                   /protein_id="ABS24611.1"
FT                   /translation="MSTAVTQGIRVEVRSAYRPDRSEAGRWLFTYTVRIANQGETPALL
FT                   AARHWIITDANGEREEVVGEGVIGQQPQLSPGDEFEYTSFCVLETPHGSMQGSYRMERP
FT                   DGSSFHARIAPFPLVAGTLN"
     gtgtcgaccg ccgtcaccca gggcatccgc gtcgaggtgc gcagcgccta ccgtccggac        60
     cgttccgagg ccggccgctg gctcttcacc tataccgtcc gcatcgccaa ccagggggag       120
     acgccggcgc tgctcgcggc gcgccactgg atcatcaccg acgcgaacgg cgagcgcgag       180
     gaggtggtcg gcgagggcgt catcggccag cagccgcagc tctcccccgg cgacgagttc       240
     gagtacacga gcttctgcgt cctggagacg ccgcacggct cgatgcaggg cagctaccgc       300
     atggagcggc ccgacggctc gtccttccac gcgcggatcg cgccgttccc gctggtggcg       360
     gggacgctga actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page