(data stored in ACNUC7421 zone)

EMBL: CP000769.PE392

CP000769.PE392       Location/Qualifiers
FT   CDS_pept        450522..451334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0397"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: ade:Adeh_4029 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24612"
FT                   /db_xref="GOA:A7H7B6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B6"
FT                   /protein_id="ABS24612.1"
FT                   /translation="MEPKLQQLLDDVRRAQGRVVALTGAGVSAESGIPTFRGREGFWVV
FT                   GSRNYMPQEMATHEMFARAPEEVWRWYLHRFGVCRDARPNAGHAALVALERALGERFTL
FT                   VTQNIDGLHRRAGSERVLCIHGDAAYVRCADGCGTGLLDLPLFPQRGKDDPLTDADRAR
FT                   LACPSCGGWLRPHVLWFDEYYDEVNYRMESALRAAAEAELLLVVGTSGATNLPMQIGRL
FT                   AFERQAALVDVNPEVNPFAELASRSSRGFFARGSACERLPAIVAALGA"
     atggaaccga agctccagca gctcctcgac gacgtgcggc gcgcgcaggg gcgggtggtc        60
     gctctcaccg gcgcgggggt ctccgccgag agcgggatcc cgaccttccg cgggcgcgag       120
     gggttctggg tggtcggctc ccggaactac atgccgcagg agatggccac ccacgagatg       180
     ttcgcgcgcg cgcccgagga ggtctggcgc tggtacctgc accgcttcgg cgtgtgccgg       240
     gacgcgcgcc cgaacgccgg ccacgcggcg ctggtggcgc tcgagcgcgc cctcggcgag       300
     cgcttcacgc tcgtcaccca gaacatcgac gggctccacc ggcgcgccgg ctcggagcgc       360
     gtcctctgca tccacgggga cgccgcgtac gtgcgctgcg cggatgggtg cgggacgggg       420
     ctcctggacc tgccgctctt cccgcagcgc gggaaggacg acccgctcac cgacgccgac       480
     cgcgcgcgcc tcgcctgtcc gtcgtgcggc ggctggctcc ggccccacgt gctctggttc       540
     gacgagtact acgacgaggt gaactaccgg atggagagcg cgctgcgcgc ggcggccgag       600
     gcggagctcc tgctcgtggt cggcacgagc ggcgcgacca acctgccgat gcagatcggc       660
     cggctcgcgt tcgagcggca ggccgcgctc gtggacgtga acccggaggt gaaccccttc       720
     gccgagctcg cgtcccgctc ctcgcggggc ttcttcgcgc gcgggagcgc ctgcgagcgg       780
     ctgcccgcca tcgtcgccgc gctgggggcc tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page