(data stored in ACNUC7421 zone)

EMBL: CP000769.PE393

CP000769.PE393       Location/Qualifiers
FT   CDS_pept        complement(451369..453690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24613"
FT                   /db_xref="GOA:A7H7B7"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7B7"
FT                   /protein_id="ABS24613.1"
FT                   /translation="MRTRSVAVIAAVFLGAAALSLFVVLQLTRERPRAVPPAAPSAPSP
FT                   SVTPPLEPAATEADGRVELRATANDAPLAGAEVRLYLQLPPRTGALEPAWLRAAEARTD
FT                   AEGIARLPARPGTYLAAVRAAGLAPAHAEVFCAPGEELTHAEVALAQPTTLDVRVVARP
FT                   DGRPVQARIVLLPSVGRGARLAPPSAPVEERLSASADGAGAARVDGLAPGSYAVAAEAP
FT                   DLHPVLLPRVEVPRAEPLAISLEPLGRISGVVRDPSGRPAAGATVRGASRDHAASATSD
FT                   AEGRYTLAAPAGAYRLIAAAGEGAAGAGPVTVQAGATTEGIALALGRAAALEGVVVDER
FT                   SGRPVPGAEVALVLHDTGALAARAVASEEGRYRLAPLAPGQYDLRAAAAGRSPAVQRGV
FT                   TLAARQTFPLDVALAGTGTIEGAVADARGGPLAGARVRVEARGDGLAGALPLEARSDFE
FT                   GRYRIEGVEVGRAELVARQDGVALGVSRAVRVAPGSTARADFSLPEAGVLAGRVSQAGG
FT                   TAPVGTAVVAVPLKAGAGTPQRARAVADARGTYRLALPAGEYRVHAAPGDADRTDLRVA
FT                   PAFARVEAGATSRLDLTAAAPTAEEGVELVILEPGGAPSPGAAVTLARAGDDRIALATS
FT                   AGEDGRVVLAKEMGLAGASITVRARSGGRSGAWTGALPASGQVAVQLERGGAIAGAVRA
FT                   RGAEPRSVVVEVASRPSADGWRVTDVHRFPGARFELADVPTGPLRLTVRADDGRRGAAE
FT                   LSLASGETRTLEIPLEPDRR"
     atgcgtaccc gctccgtcgc cgtcatcgcc gccgtgttcc tcggcgccgc ggcgctgtcg        60
     ctcttcgtcg tcctccagct gacgcgcgag cggccccgcg ccgtcccgcc cgcggcgccg       120
     tcggccccat caccctcggt gacgccgccg ctggagcccg ccgcgaccga ggcggacggg       180
     cgcgtcgagc tgcgcgccac ggcgaacgac gcgccgctcg ccggcgcgga ggtgcggctg       240
     tacctgcagc tcccgccccg gaccggcgcg ctcgagccgg cgtggcttcg cgccgccgag       300
     gcgcgcaccg acgcggaggg gatcgcgagg ctgccggcgc ggccgggcac gtacctcgcc       360
     gcggtccggg ccgccgggct cgctcccgcg cacgcggagg tgttctgcgc gccgggcgag       420
     gagctcacgc acgcggaggt ggcgctcgcg cagccgacca ccctcgacgt gcgcgtcgtc       480
     gcccgtccgg acgggaggcc ggtgcaggcg cgcatcgtgc tgctcccgtc ggtcggccgg       540
     ggggcgcggc tggcgccgcc gtcggcgccc gtggaggagc gtctctcggc gtcggcggac       600
     ggcgccggag cggcgcgagt cgacgggctc gcccccgggt cctacgccgt cgccgccgag       660
     gcgccggacc tccaccccgt cctcctgccg cgcgtggagg tcccgcgggc cgagccgctc       720
     gcgatctcgc tcgagccgct gggccgcatc tccggcgtcg tccgcgatcc ctccggccgg       780
     cccgcggcgg gcgcgaccgt gcgcggcgcc tcgcgcgacc acgccgcgag cgcgacctcc       840
     gacgcggagg gtcgttacac gctcgccgcg cccgcgggcg cctaccggct catcgccgcc       900
     gccggggagg gcgccgccgg agcgggtccg gtgacggtgc aggccggcgc gacgacggag       960
     gggatcgcgc tcgcgctcgg gcgcgcggcc gccctggagg gcgtggtcgt cgacgagcgc      1020
     tcgggccggc ccgtgcccgg cgcggaggtg gcgctcgtcc tccacgacac cggcgcgctc      1080
     gccgcgcgcg ccgtcgcgag cgaggaggga cggtaccggc tcgccccgct cgcgcccggc      1140
     cagtacgacc tgcgcgcggc cgcggccggg aggagccccg ccgtgcagcg cggcgtgacg      1200
     ctcgccgccc gtcagacctt cccgctcgac gtcgcgctcg ccggcaccgg cacgatcgag      1260
     ggcgcggtcg ccgacgcgcg cggcgggccg ctcgcgggcg cacgggtccg cgtcgaggcc      1320
     cgcggggacg ggctcgcggg cgcgctcccc ctggaggcgc ggagcgactt cgagggacgc      1380
     taccgcatcg agggcgtcga ggtggggcgc gccgagctcg tcgcgcgcca ggacggcgtg      1440
     gcgctcgggg tctcgcgggc cgtgcgcgtc gcccccgggt ccacggcccg cgccgacttc      1500
     tcgctccccg aggccggggt cctggccggg cgcgtgagcc aggccggagg gaccgcgccg      1560
     gtgggcaccg cggtggtcgc cgtcccgctg aaggccgggg ccggcacccc gcagcgcgct      1620
     cgtgccgtgg ccgacgcgcg ggggacctac cggctcgcgc tcccggccgg cgagtaccgg      1680
     gtccacgccg cgcccggcga cgccgatcgc accgacctcc gtgtggcgcc ggcgttcgcg      1740
     cgcgtcgagg cgggagcgac ctcgcggctc gacctcaccg cggccgcgcc caccgccgag      1800
     gagggggtgg agctggtgat cctcgagccc ggcggcgcgc cgtcgccggg cgcggcggtc      1860
     acgctggcgc gggccggaga cgaccgcatc gcgctcgcga cgagcgcggg cgaggacggc      1920
     cgcgtcgtgc tcgcgaagga gatggggctc gcgggtgcct cgatcacggt gagggcgcgc      1980
     agcggcggcc ggagcggcgc gtggacgggc gcgctcccgg cctccggcca ggtggcggtc      2040
     cagctcgagc ggggcggcgc catcgcgggc gccgtgcgtg cgcgcggggc cgagccgagg      2100
     agcgtcgtcg tcgaggtggc ctcccggccg tccgccgacg gctggcgcgt cacggacgtg      2160
     caccggttcc cgggcgcgcg cttcgagctg gcggacgtcc ccaccggtcc gctgcgcctc      2220
     accgtgcgcg ccgacgacgg ccggcgcggg gccgccgagc tgagcctcgc ctccggcgag      2280
     acgcgcacgc tcgagatccc gctcgagccg gaccggcggt ga                         2322
//

If you have problems or comments...

PBIL Back to PBIL home page