(data stored in ACNUC7421 zone)

EMBL: CP000769.PE40

CP000769.PE40        Location/Qualifiers
FT   CDS_pept        complement(53988..54431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0040"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   ade:Adeh_0037 amino acid-binding ACT"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24260"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A7H6B4"
FT                   /protein_id="ABS24260.1"
FT                   /translation="MKIRQLSLFLENRPGQLRFPCKVLGDAGIDILTMSLADTAQFGIL
FT                   RLVVKEWQRAREVLEAAGVVVNVTEVLAVDVPDRPGGLAGVLEAFEKAGVGVEYMYAFA
FT                   SRERGRHATLLFRLEDPDRAAKLLEAAGVKLVPSDELFARSGA"
     gtgaagatcc gccagctctc gctgttcctc gagaaccgcc ccggccagct gcgcttcccc        60
     tgcaaggtgc tgggcgacgc cggcatcgac atcctcacca tgtcgctcgc cgacaccgcg       120
     cagttcggca tccttcgcct agtggtgaag gagtggcagc gcgccaggga ggtgctcgag       180
     gcggccgggg tcgtggtgaa cgtcaccgag gtgctcgcgg tcgacgtgcc cgatcgcccg       240
     ggcgggctcg ccggggtgct cgaggcgttc gagaaggccg gggtgggcgt cgagtacatg       300
     tacgcgttcg cgtcccgcga gcgcggccgc cacgccaccc tgctcttccg gctcgaggac       360
     cccgaccgcg ccgcgaagct cctcgaggcg gcgggcgtga agctcgtccc ctccgacgag       420
     ctcttcgccc gctcgggcgc gtag                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page