(data stored in ACNUC7421 zone)

EMBL: CP000769.PE400

CP000769.PE400       Location/Qualifiers
FT   CDS_pept        458136..459512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0405"
FT                   /product="amino acid/peptide transporter"
FT                   /note="TIGRFAM: amino acid/peptide transporter; PFAM:
FT                   TGF-beta receptor type I/II extracellular region; major
FT                   facilitator superfamily MFS_1; KEGG: ade:Adeh_4020 amino
FT                   acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24620"
FT                   /db_xref="GOA:A7H7C4"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C4"
FT                   /protein_id="ABS24620.1"
FT                   /translation="MARTERYPPQVKYIVGNELCERFSFYGMRSILTLYMMQYLLFAQQ
FT                   DAKAYFHYFVMANYLTPLLGGWIADRFWGRYRTILWISLGYVGGHAVLAIWETPAGLLA
FT                   GLSLIALGAGGIKPCVSAFVGDQFGPTQKTLMQRVYGWFYWSINLGSASANLLIPWLLK
FT                   RHGPSVAFAIPGVLMALSLLVFWAGTKHYVQAPPSGPNPHGFLRVVGRAVRRAGTGRAG
FT                   EHWLDVARDQHPPEAIAGAKAVFRIMGVFAAVTLFWTLFDQKASSWVIQASQMDLVVRG
FT                   WEMSPAQLQAANPFLVMTLIPLFTWGVFPFLERRGVELSPLRKMTAGMFLTALSFGAAA
FT                   IVQTFVDRGGAPPSALWQLPQYVLLTVGEVLVSVTGLEFSYTQAPKTMRSTIMSLWFLT
FT                   IALGNLLTAVLTRVVSLEGAAYFWLFAGLMLAAAFAFREVARRYRPVPAAVEAGVVAEG
FT                   "
     atggcccgca ccgagcgcta tccaccccag gtcaagtaca tcgtcggcaa cgagctctgc        60
     gagcgcttct cgttctacgg gatgcgctcc atcctgacgc tctacatgat gcagtacctg       120
     ctcttcgccc agcaggacgc gaaggcgtac ttccactact tcgtgatggc gaactacctc       180
     acgccgctcc tcggcgggtg gatcgccgac cggttctggg gccgctaccg caccatcctg       240
     tggatctcgc tcggctacgt cggcgggcac gcggtgctcg ccatctggga gacgcccgcg       300
     ggcctcctcg ccggcctgtc gctcatcgcg ctcggcgcgg gcggcatcaa gccctgcgtg       360
     tcggcgttcg tgggcgatca gttcggcccc acccagaaga cgctcatgca gcgggtctac       420
     ggctggttct actggtccat caacctcggc tcggcgtccg ccaacctgct catcccctgg       480
     ctcctgaagc ggcacggccc gtccgtcgcg ttcgcgatcc ccggcgtcct catggcgctc       540
     tcgctcctgg tgttctgggc ggggacgaag cactacgtgc aggcgccgcc ctccggtccc       600
     aacccgcacg gcttcctgcg cgtggtcggc cgcgcggtgc gccgggccgg caccgggcgc       660
     gccggcgagc actggctcga cgtggcgcgc gaccagcacc cgccggaggc gatcgccggc       720
     gcgaaggcgg tcttccgcat catgggcgtg ttcgcggcgg tgacgctctt ctggaccctg       780
     ttcgaccaga aggcctcgtc gtgggtcatc caggcgagcc agatggacct cgtggtccgc       840
     ggctgggaga tgtcgccggc gcagctccag gcggcgaacc cgttcctggt gatgacgctc       900
     atcccgctct tcacctgggg tgtgttcccg ttcctcgagc ggcgcggcgt cgagctctcg       960
     ccgctccgga agatgacggc ggggatgttc ctcaccgcgc tctccttcgg cgcggcggcg      1020
     atcgtgcaga cgttcgtcga tcgcggcggc gccccgccga gcgcgctctg gcagctcccc      1080
     cagtacgtgc tgctcacggt gggggaggtg ctcgtctcgg tgaccggcct cgagttcagc      1140
     tacacccagg cgccgaagac catgcggagc acgatcatgt cgctctggtt cctgacgatc      1200
     gcgctcggga acctgctcac cgccgtgctg acgcgggtgg tctcgctcga gggcgccgcc      1260
     tacttctggc tcttcgccgg cctcatgctc gccgccgcgt tcgcgttccg cgaggtggcg      1320
     cggcggtacc ggccggtgcc ggcggccgtc gaggcggggg tggtggcgga ggggtga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page