(data stored in ACNUC7421 zone)

EMBL: CP000769.PE403

CP000769.PE403       Location/Qualifiers
FT   CDS_pept        464664..464846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_4015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24623"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7C7"
FT                   /protein_id="ABS24623.1"
FT                   /translation="MRPLAQAAALAAALALAGPTAVAAAPRSPPGQFIEDDYDRARADA
FT                   RARGVPLVVDVWAPW"
     atgcgaccgc tcgcccaagc cgccgccctc gccgccgcgc tcgccctcgc cgggccgacc        60
     gccgtggccg cggcgcccag gagcccgccc ggccagttca tcgaggacga ctacgatcgc       120
     gcccgcgccg acgcgcgcgc gcgcggcgtg ccgctcgtgg tggacgtctg ggccccctgg       180
     tga                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page