(data stored in ACNUC7421 zone)

EMBL: CP000769.PE409

CP000769.PE409       Location/Qualifiers
FT   CDS_pept        complement(470799..471956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0414"
FT                   /product="outer membrane protein, OmpA/MotB family"
FT                   /note="KEGG: ade:Adeh_4010 outer membrane protein,
FT                   OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24629"
FT                   /db_xref="GOA:A7H7D3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D3"
FT                   /protein_id="ABS24629.1"
FT                   /translation="MRRIGERLDGERPSWGGARYDGVRMHRHALPFALAIALGCATAPV
FT                   EPLSTLTPNGAILRGADLARTRCLLVAPFENASDVALAAEAATSAFVSGVDPSRARVFP
FT                   IPELREVFRDTPLELPAGIAPSLALELAELVGADAAVYGTVEGGGKGEDAPLLVSVRVA
FT                   VTGAHRLLFARNAVVRAQPGEAPEDAVRRTVDELARPLLARIGDPGRKQCFDPERTRAL
FT                   RRFALAEPRPDRRAEPQSAPGPAVAPVAATSAPAAAAPRTPRQTEWARKLAAGERLVVD
FT                   DVAFAGRTAELLRDGGLADLAIALAAAPGVTVRIEAFVDASDDRAGDGKLSEEMARTAG
FT                   ERLHQLGVARARLAWSGRGGESPLLPNFTARGRAANRRIEVAPGR"
     atgcgacgga tcggtgaacg gctcgacggc gagcgtccct cgtggggcgg cgcgcgttac        60
     gatggcgtgc gcatgcaccg ccacgccctc cccttcgcgc tggcgatcgc gctcggctgc       120
     gcgaccgcgc ccgtcgagcc cctctccacc ctcaccccga acggcgccat cctgcgcgga       180
     gccgacctcg cgcggacgcg ctgcctgctg gtcgcgccct tcgagaacgc ctccgacgtc       240
     gcgctggcgg cagaggcggc gacctccgcg ttcgtgtccg gcgtcgaccc ctcgcgcgcc       300
     cgcgtgttcc cgatccccga gctgcgcgag gtgttccgcg acacgccgct cgagctcccc       360
     gccgggatcg cgccgagcct cgcgctcgag ctcgcggagc tcgtcggcgc cgacgcggcg       420
     gtctacggga cggtggaggg cggggggaag ggcgaggacg ccccgctgct cgtctccgtc       480
     cgcgtcgcgg tgaccggcgc ccaccgcctg ctgttcgcgc gcaacgcggt ggtccgggcc       540
     cagcccggcg aggcgcccga ggacgcggtg cggcgcacgg tcgacgagct cgcccgcccg       600
     ctgctcgccc gcatcggaga cccgggacgc aagcagtgct tcgatccgga gcgcacccgc       660
     gcgctccggc gcttcgccct cgccgagccg aggccagacc gccgcgccga gccgcagtcg       720
     gcgccgggcc cggccgtggc gcccgtggcg gccacgagcg cgcccgcggc ggccgcgccg       780
     cgcacgccgc gccagacgga gtgggcccgc aagctcgcgg cgggcgagcg gctcgtcgtc       840
     gacgacgtgg cgttcgcggg ccggaccgcg gagctgctcc gcgacggcgg cctggccgac       900
     ctcgccatcg cgctcgccgc ggcgccgggc gtgacggtgc ggatcgaggc gttcgtcgac       960
     gcgagcgacg atcgcgccgg cgacggcaag ctctcggagg agatggcgcg caccgcagga      1020
     gagcggctgc atcagctcgg cgtcgcgcgt gcccggctcg cctggtccgg gcgaggcggc      1080
     gagagcccgc tcctccccaa cttcacggcg cgcgggcgcg ccgcgaaccg ccgcatcgag      1140
     gtggccccgg ggcggtga                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page