(data stored in ACNUC7421 zone)

EMBL: CP000769.PE411

CP000769.PE411       Location/Qualifiers
FT   CDS_pept        472702..473835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0416"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; KEGG: ade:Adeh_4008 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24631"
FT                   /db_xref="GOA:A7H7D5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D5"
FT                   /protein_id="ABS24631.1"
FT                   /translation="MFGRTPLAAAIQALRAELAGGPRADLGRDVRELADLLSARAQRRP
FT                   GTLYPEAPEQELLAALPDAAALVSREGWVRVSNAAFDTLAATGRAAGLTPLEITRSAEL
FT                   SEAVRRALEGTARRLDLQLGRRSYLVHLAPLLRGEVLLSLRDVTEARRAEATRRDFVAN
FT                   ASHELRTPVAAIRAAAETLLAGAVDDPAGARQFVEIVARQAERLARLTEDLLDLSRLES
FT                   RQWSFDLAPVDAAAVSTQAVELLALTARDKGLEIAAEVPAGATVRADARALEQVLVNLL
FT                   DNAVKYTGEGEVTLRGERDGDAWVLSVADTGPGIDRHHLPRIFERFYRIDAGRSREQGG
FT                   SGVGLAIVKHLVQGMGGEVGVESGTGGTRFWVRLPAV"
     atgttcggtc gaacgccgct cgcggccgcg atccaggcgc tgcgcgccga gctcgccggc        60
     ggcccgcgcg ccgacctcgg gcgcgacgtc cgcgagctcg cggatctcct ctccgcgcgc       120
     gcgcagcggc gccccgggac gctctatccg gaggcacccg agcaggagct gctcgcggcg       180
     ctccccgacg cggcggcgct cgtctcgcgc gaggggtggg tccgggtgtc gaacgcggcg       240
     ttcgacacgc tggccgcgac cggacgcgcg gcggggctca cgcccctcga gatcacccgc       300
     agcgcggagc tctcggaggc cgtgcggcgc gcgctcgagg gcaccgcgag gcggctcgac       360
     ctgcagctcg gccgccgcag ctacctcgtc cacctcgcgc cgctcctgcg gggcgaggtg       420
     ctcctctcgc tgcgcgacgt caccgaggca cggcgcgcgg aggcgacgcg gcgcgacttc       480
     gtggccaacg cgagccacga gctccgcacc cccgtggcgg cgatccgcgc cgcggcggag       540
     acgctcctcg ccggcgcggt cgacgatccc gcgggcgcgc gtcagttcgt ggagatcgtg       600
     gcgcggcagg ccgagcggct cgcgcgcctc accgaggatc tcctcgacct ctcgcgcctc       660
     gagtcgcggc agtggagctt cgacctcgcg cccgtggacg cggcggcagt gtccacgcag       720
     gccgtggagc tgctcgccct caccgcacgc gacaaggggc tcgagatcgc cgcggaggtc       780
     cccgccggcg ccaccgtgcg cgcggacgcg cgcgccctcg agcaggtcct cgtgaacctg       840
     ctcgacaacg cggtgaagta caccggggag ggcgaggtca cgctgcgcgg cgagcgcgac       900
     ggcgacgcgt gggtgctctc cgtcgccgac accggccccg ggatcgaccg gcatcacctg       960
     ccgcgcatct tcgagcggtt ctaccgcatc gacgccggcc gctcgcgcga gcagggcggc      1020
     agcggcgtcg ggctcgccat cgtgaagcac ctcgtccagg gaatgggcgg cgaggtcggg      1080
     gtggagagcg gcacgggcgg gacgcggttc tgggtgcgcc tcccggccgt gtga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page