(data stored in ACNUC7421 zone)

EMBL: CP000769.PE415

CP000769.PE415       Location/Qualifiers
FT   CDS_pept        477086..478000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0420"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ade:Adeh_4004 ABC
FT                   phosphate transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24635"
FT                   /db_xref="GOA:A7H7D9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7D9"
FT                   /protein_id="ABS24635.1"
FT                   /translation="MSVASRKVVGTGLTVLTGATAALVVAMLAVILVDVVRGGAARVSW
FT                   EFLTAAPEEGMTAGGIFPAIYGTAIMTLIMTVAVMPVGVLTAVYLHEYAAPRSRMAALV
FT                   RVAVTNLAGVPSIVFGLFGLGFFIQFVGGSLDRAFSPPGELFYGRPALLWAALTLAVLT
FT                   LPVVIVSTEEALRAVPRDHRDASLALGATKSQTLVRVILPQALPGILTGAILAVARGAG
FT                   EVAPILFTGVAYFLPDLPGSVWSQFMHLGYHVYVLATQSPDIDATRPLLYATVFVLLAL
FT                   TFALNLLAIAIRTRTRRKAAAGH"
     gtgagcgtcg cgagccgcaa ggtcgtcggc acggggctga ccgtgctcac cggcgccacc        60
     gccgcgctgg tggtggcgat gctggcggtc atcctggtgg acgtggtccg cgggggcgcc       120
     gcgcgggtga gctgggagtt cctcaccgcg gcgcccgagg agggcatgac ggccggcggg       180
     atcttccccg ccatctacgg cacggcgatc atgacgctca tcatgaccgt cgccgtgatg       240
     ccggtcggcg tcctcaccgc cgtctacctc cacgagtacg cggcgccccg ctcgcgcatg       300
     gccgccctgg tgcgcgtggc ggtgacgaac ctcgccggcg tcccctccat cgtgttcggg       360
     ctcttcggcc tcggcttctt catccagttc gtcggcggct cgctcgatcg cgccttctcg       420
     ccgccgggcg agctgttcta cggccggccc gccctcctgt gggccgcgct cacgctcgcg       480
     gtgctcacgc tgccggtggt catcgtctcg accgaggagg cgctccgggc cgtgccgcgc       540
     gatcaccgcg acgcgagcct cgccctcggc gcgacgaagt cccagaccct ggtgcgcgtg       600
     atcctgcccc aggcgctgcc cggcatcctc accggcgcga tcctggccgt cgcgcgcggc       660
     gcgggcgagg tggcgcccat cctgttcacg ggggtcgcct acttcctgcc cgatctgccc       720
     ggctccgtct ggtcgcagtt catgcacctc ggctaccacg tgtacgtgct cgcgacgcag       780
     tcgccggaca tcgacgcgac ccgcccgctg ctctacgcga cggtgttcgt gctgctcgcg       840
     ctcaccttcg ccctgaacct cctcgcgatc gcgatccgca cccgcacccg ccgcaaggcg       900
     gccgccggac actga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page