(data stored in ACNUC7421 zone)

EMBL: CP000769.PE422

CP000769.PE422       Location/Qualifiers
FT   CDS_pept        complement(482801..483778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0427"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; KEGG:
FT                   mxa:MXAN_0035 ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24642"
FT                   /db_xref="GOA:A7H7E6"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7E6"
FT                   /protein_id="ABS24642.1"
FT                   /translation="MRRRAPLLALALSAALGCSRAKGPDAPLRLGYFPNVTHAQALVGV
FT                   DDGTFARALSGRLETRMFNAGPAAMEALLAGDLDASYVGPGPAAIAFLRTHGEALRVVA
FT                   GAASGGAALVVKDARAPKDLAGKRVASPQLGNTQDVALRMWLRQQGLQDARGQGPVEVT
FT                   PLANPDILALFARGDLAGAWVPEPWAARLVAEAGGRILVDERSLWPEGRFPITVLVVSA
FT                   RALERRRADVIALVRAHLELTRRWEADRAAFARLANAAYGKRAGKALPDAVLLDALSRV
FT                   EPVSDPLPRQLERMARDAQELGFAPKGDPSGIVDATMLQEIARR"
     atgaggcgcc gcgccccgct cctcgcgctc gccctctccg ccgcgctcgg ctgctctcgc        60
     gcgaagggtc cggacgcgcc gctgcggctc ggctacttcc cgaacgtcac acacgcgcag       120
     gcgctcgtgg gggtggacga cggcaccttc gcgcgggcgc tgtcgggcag gctcgagacg       180
     cgcatgttca acgccgggcc cgcggcgatg gaggcgctgc tcgcgggcga cctcgacgcg       240
     agctacgtcg gccccggccc cgccgccatc gccttcctgc gcacccacgg cgaggcgctc       300
     cgcgtggtcg cgggggccgc ctccggcggc gccgcgctcg tcgtgaagga cgcgcgcgcc       360
     ccgaaggacc tcgccggcaa gcgggtcgcc tccccgcagc tcggcaacac ccaggacgtc       420
     gcgctccgca tgtggctgcg ccagcaaggg ctccaggacg cgcgcgggca gggcccggtg       480
     gaggtgacgc cgctcgcgaa ccccgacatc ctcgcgctct tcgcgcgcgg cgacctcgcc       540
     ggcgcgtggg tccccgagcc ctgggcggcg cgcctcgtgg cggaggcggg agggaggatc       600
     ctcgtcgacg agcgatcgct ctggccggag ggacgcttcc ccatcacggt cctcgtcgtg       660
     tccgcgcgcg ccctggagcg gcggcgcgcc gacgtgatcg cgctcgtgcg cgcgcacctc       720
     gagctcaccc gccgctggga ggcggaccgc gccgcgttcg cgcggctcgc gaacgcggcg       780
     tacggcaagc gcgccggcaa ggcgctcccc gacgccgtgc tcctcgacgc gctctcgcgc       840
     gtggagccgg tgtcggaccc gcttccccgc cagctggagc gcatggcgcg cgacgcgcag       900
     gagctcgggt tcgcccccaa gggcgacccg tcgggtatcg tggacgcgac catgctccag       960
     gagatcgcgc gccgatga                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page