(data stored in ACNUC7421 zone)

EMBL: CP000769.PE429

CP000769.PE429       Location/Qualifiers
FT   CDS_pept        490513..491298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cph:Cpha266_1734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24649"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F3"
FT                   /protein_id="ABS24649.1"
FT                   /translation="MREVVVAVLSLGFALGARAAEFEGKAEYRVKGVGAGPARDGSAVV
FT                   YLSPKGSRSEVEIAASPELASQGMTEPMRMISIVKAGEPGRAYVVNPGTKSYSVLDGQP
FT                   EGKAGSWTVERAGSDRVGGVGCERARISGSGGERFEVCITRELGTVGSWAASGGGQDAE
FT                   LPRALKKAGLDGLPARWSVVDPATGAPQMTMELVRAARQKVPAAMFEIPAGYAKTSVPQ
FT                   ASPEMQRKLEEAMKDMPPEQRKQLEEMMRRGGGDRPPGR"
     atgcgtgagg tcgtggtcgc ggtgctctcg ctggggttcg cgctcggcgc gcgcgcggcg        60
     gagttcgagg gcaaggcgga gtaccgggtg aagggggtgg gggcgggccc cgcgcgcgac       120
     ggcagcgccg tcgtctacct gtcgcccaag gggtcgagga gcgaggtcga gatcgccgcg       180
     tcgcccgagc tggcgagcca ggggatgacc gagccgatgc ggatgatctc gatcgtgaag       240
     gcgggcgagc cgggccgcgc ctacgtcgtg aacccgggca cgaagagcta cagcgtcctg       300
     gacgggcagc ccgaggggaa ggcggggagc tggacggtgg agcgcgccgg cagcgatcgc       360
     gtgggcggcg tcggctgcga gcgcgcgcgg atctccggct ccggcggcga gcgcttcgag       420
     gtctgcatca cccgcgagct cgggaccgtc gggtcctggg cggcgagcgg cggcggccag       480
     gacgccgagc tcccccgcgc gctgaagaag gccggcctcg acgggctccc cgcgcgctgg       540
     agcgtcgtcg atccggcgac gggcgcgccg cagatgacga tggagctcgt gcgcgcggcg       600
     cggcagaagg tcccggccgc gatgttcgag atcccggccg gctacgcgaa gacctccgtc       660
     ccgcaggcct cgcccgagat gcagcgcaag ctggaggagg ccatgaagga catgccgccc       720
     gagcagcgca agcagctcga ggagatgatg cgccgcggcg gtggggatcg gccgccgggc       780
     aggtga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page