(data stored in ACNUC7421 zone)

EMBL: CP000769.PE431

CP000769.PE431       Location/Qualifiers
FT   CDS_pept        492255..493088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24651"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7F5"
FT                   /protein_id="ABS24651.1"
FT                   /translation="MRRQVKGEAVRRELLPGTSPELLKELHLLTRAGDLNADSLRKLKQ
FT                   VNHLAGLLAPALDDVLARFGDPVLVDCGAGKSYLGFVLYELFLRAAGKGRLLALESRPE
FT                   LARAGAERAARLGFERLRFVEASIAAAPVPERVHLVTALHACDTATDDALALAIRHGAD
FT                   HVAVVPCCQAEVARQLAGAPAPSPLLAPLFDHPWHRREFGSHLTNVVRALALEAAGYKV
FT                   TVTELTGWEHSLKNELILGRKVRSGSREARERLDALLAAAGVRPKLVRLLAGEEA"
     atgcgccgcc aggtgaaagg ggaggccgtc cgccgcgagc tcctccccgg tacgtccccg        60
     gagctcctga aggagctgca cctcctcacg cgcgcgggcg acctcaacgc ggacagcctg       120
     cgcaagctca agcaggtgaa ccacctcgcc gggctgctcg cgccggcgct cgacgacgtg       180
     ctcgctcgct tcggcgaccc ggtcctcgtc gactgcggcg cgggcaagag ctacctcggc       240
     ttcgtcctgt acgagctgtt cctgcgcgcc gccggcaagg ggcggctgct cgcgctcgag       300
     tcgcgtcccg agctggcgcg cgccggggcg gagcgggccg cccggctcgg cttcgagcgg       360
     ctgcgcttcg tggaggcgtc catcgcggcg gcgccggtgc ccgagcgcgt ccacctggtg       420
     accgcgctcc acgcctgcga caccgccacc gacgacgcgc tggcgctcgc gatccgccat       480
     ggcgccgacc acgtcgcggt ggtcccctgc tgccaggccg aggtcgcgcg ccagctcgcg       540
     ggggcgcccg cgccgtcccc gctgctcgcg ccgctcttcg accacccgtg gcaccggcgc       600
     gagttcggat cgcacctcac caacgtggtg cgcgcgctcg ccctcgaggc cgccggctac       660
     aaggtcaccg tgacggagct caccggctgg gagcactcgt tgaagaacga gctcatcctg       720
     ggccggaagg tgcggtccgg ctcgcgcgag gccagggagc ggctcgacgc gctcctcgcg       780
     gccgccgggg tgcggccgaa gctcgtccgg ctcctcgcgg gcgaggaggc gtag             834
//

If you have problems or comments...

PBIL Back to PBIL home page