(data stored in ACNUC7421 zone)

EMBL: CP000769.PE436

CP000769.PE436       Location/Qualifiers
FT   CDS_pept        complement(497727..498653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24656"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G0"
FT                   /protein_id="ABS24656.1"
FT                   /translation="MIRPMAPLLDRAIDGLAMWMEDRRPREPMGFRPAPAASLDCFGPL
FT                   PVLPAGPPREGAWHAPSPRPAEGDATMAVHAQAARGPRRGTALLVPPWKVPRLAAVSGY
FT                   ARLLARAGYAVWTLVPPRHLHRAPPGLRSGEGFVSPDLPALRAAFEQLVLEIRILVTLA
FT                   RAEGGTVGVVGLSLGALGAALAATAPEPLDFAALVAPPADLAAVFAGTPIGRRYLSLAR
FT                   RAGAPVPPPDALSRMLAPFRADQRRPTARRVLVAVGTDDRIALGAGALGLAAAWGAAAR
FT                   RYPRGHLTLLFACRALRRDLARFVAAG"
     atgatccgcc cgatggcacc gctcctcgac cgcgcgatcg acgggctcgc gatgtggatg        60
     gaggatcggc gcccgcgaga gccgatgggc ttccgcccgg cacccgccgc ttcgctcgac       120
     tgcttcgggc cgctgccggt cctgcccgca gggcctcctc gcgagggcgc gtggcacgcg       180
     ccctcgccgc gtccggccga aggagacgcg accatggccg tccacgcgca ggcggcccgc       240
     ggcccgcggc gcggcacggc gctcctcgtg cctccgtgga aggtcccgcg cctcgcggcc       300
     gtctcgggct acgcgcggct cctcgcgcgc gcgggctacg ccgtctggac gctcgtgccg       360
     ccgcgccacc tccatcgcgc gccgccgggc ctccgcagcg gcgaggggtt cgtctcgccc       420
     gacctgcccg cgctgcgggc ggccttcgag cagctcgtgc tcgagatccg gatcctcgtg       480
     acgctcgcgc gcgccgaggg cggaacggtg ggcgtggtgg ggctctcgct cggcgcgctc       540
     ggcgcggcgc tcgcggccac ggcgccggag ccgctcgact tcgcggcgct cgtcgcgcct       600
     cctgcggatc tcgccgccgt gttcgcgggg acgccgatcg gacgccgcta cctgtccctc       660
     gctcgccgcg cgggcgcgcc ggtgccgccg ccggacgcgc tctcgcgcat gctcgcgccc       720
     tttcgcgccg accagcgccg ccccaccgcg cggcgcgtgc tcgtggcggt ggggacggac       780
     gatcggatcg cgctgggcgc gggcgcgctc gggctcgccg ccgcgtgggg agccgccgcg       840
     cggcgctacc cgcgcggcca cctcaccctg ctcttcgcct gccgcgcgct ccggcgcgac       900
     ctcgcccgct tcgtcgcggc cggctga                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page