(data stored in ACNUC7421 zone)

EMBL: CP000769.PE443

CP000769.PE443       Location/Qualifiers
FT   CDS_pept        complement(503590..504909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Anae109_0448"
FT                   /product="NusB/RsmB/TIM44"
FT                   /note="PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44;
FT                   KEGG: ade:Adeh_3970 NusB/RsmB/TIM44 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Anae109_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABS24663"
FT                   /db_xref="GOA:A7H7G7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A7H7G7"
FT                   /protein_id="ABS24663.1"
FT                   /translation="MSARQIAFEVLRRVDEGGAYASRALDAALTGAGALDPREAGLATE
FT                   LVYGTLRRSLTLDAALAPHSRRPVGALDPPARVALRLGAYQLLFMGKPPHAAVGETVSL
FT                   VKAVDHGRAAGYVNAVLRALARAPALPEPPPLSVDPAGHVALAEALPRWLAEEWVEWLG
FT                   PAEALALARGMNQPAPLTVRSPARDALVERARSAGLAAEPTRRSPDGVLLAGASVAALA
FT                   RAAGGLPFQVQDEAAQLVTLYAAGGLRGTRARVLDACAAPGGKAFHLAEQLAPGSEVVA
FT                   VELHPRKAEELAREAARRGLAGVRVVCADAARPIPGLEAGSFDAVLVDAPCAGLGTLRR
FT                   HPELKLRRVPEDLARMAVLQADVLAGVARYARPGAPITYSICSLSRVEGPRVVEAALRS
FT                   GLARAGGGAVPSDVLTAEGDLLTLPHRHGTDGFYAARLVG"
     atgagcgcgc gccagatcgc cttcgaggtc ctgcgccggg tggacgaggg cggcgcgtat        60
     gcctcgcgcg ccctggacgc cgcgctgacg ggagccggcg ccctcgatcc gcgcgaggcc       120
     ggcctcgcca ccgagctcgt gtacgggacg ctccgccgct cgctgacgct cgacgcagcc       180
     ctcgcgcccc actcgcgacg gcccgtcggc gcgctggacc cgcccgcccg cgtggcgctc       240
     cggctcggcg cctatcagct gctgttcatg gggaagcccc cccacgctgc ggtcggcgag       300
     accgtctccc tcgtgaaggc ggtcgatcac ggccgcgcgg cggggtacgt gaacgcggtg       360
     ctgcgcgccc tagcccgcgc gccggcgctc cccgagccgc cgccgctctc ggtcgatccg       420
     gccgggcacg tcgcgctcgc cgaggcgctg ccgcgctggc tcgcggagga gtgggtcgag       480
     tggctcgggc ccgcggaggc gctcgccctc gcgcgcggca tgaaccagcc cgcgccgctc       540
     acggtgcgct ccccggcgcg agacgcgctc gtcgagcgcg cccgctccgc cggcctcgcc       600
     gcggagccca cccggcgctc gccggacgga gtcctgctcg ccggcgcctc ggtcgccgcg       660
     ctcgcccgcg cggcgggagg gctccccttc caggtgcagg acgaggccgc tcagctcgtg       720
     acgctctacg cggcgggcgg gctgcgcggc acccgcgcgc gcgtgctcga cgcctgcgcc       780
     gcgcccggcg ggaaggcgtt ccacctcgcc gagcagctcg cgccgggctc ggaggtcgtc       840
     gcagtggagc tccatccgcg caaggcggag gagctcgcgc gcgaggcggc gcggcgcggc       900
     ctcgccggcg ttcgcgtcgt ctgcgccgac gcggcgcggc cgatcccggg gctcgaggcc       960
     ggctccttcg acgccgtgct cgtggacgct ccctgcgccg gcctcggcac gctgcgccgc      1020
     cacccggagc tgaagctccg ccgcgtgccc gaggacctcg cccggatggc cgtcctgcag      1080
     gctgacgtgc tggcgggcgt cgcgcgctac gcgcgccccg gcgcgccgat cacctactcc      1140
     atctgctcgc tgtcgcgggt cgaggggcct cgcgtcgtcg aggccgcgct ccggagcggc      1200
     ctcgcgcgcg ccgggggcgg cgcggtgccg tccgacgtgc tcacggcgga gggggatctc      1260
     ctcaccctgc cccaccgcca cggcaccgac ggtttctacg ccgctcgcct ggtcgggtga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page